KEGG   Salmo salar (Atlantic salmon): 100195374
Entry
100195374         CDS       T04363                                 

Gene name
spop
Definition
(RefSeq) speckle-type POZ protein
  KO
K10523  speckle-type POZ protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100195374 (spop)
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     100195374 (spop)
SSDB
Motif
Pfam: BTB MATH BACK
Other DBs
NCBI-GeneID: 100195374
NCBI-ProteinID: NP_001133875
UniProt: B5X432
LinkDB
Position
ssa06
AA seq 374 aa
MSRVPSPPPPADMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSG
ANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK
VPDCRLADELGGLWEHSRFTDCSLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNR
VEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCTSLSVE
NTAEILILADLHSADQLKTQAVDFINYHAAEVMETSGWKSMVASHPHLVAEAYRSLASAQ
CPFLGPPRKRLKQS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtcaagagtcccgagtccccctccccccgcggacatgtccagcggccctgtggctgag
agctggtgttacactcagattaaagtggtgaagttctcttacatgtggaccatcaacaac
ttcagcttctgtcgcgaggagatgggcgaggtcatcaagagctccaccttctcttcggga
gccaatgacaagcttaaatggtgtttgcgtgtaaaccctaaaggcctggacgaggagagt
aaagactacctgtccctctacctgctcctggtcagctgtcccaagagcgaggtgcgtgcc
aagttcaagttctccatcctcaatgccaagggagaggagactaaggctatggagagccag
agggcataccggtttgtccaggggaaggactggggctttaagaaattcatcaggagagac
ttcctgctggacgaggccaatgggctgctgcctgacgacaagctcactctcttctgtgag
gtgagtgtggtgcaggactctgtgaacatctcaggacagaacactatgaacatggtgaag
gtgccagactgcaggctggccgatgagctgggagggctgtgggaacactcccgcttcact
gactgctccctgtgtgtggcgggacaggagttccaggcacacaaagccatcctggcagcc
cgatcgccagtgttcagtgccatgtttgagcatgagatggaggagagtaaaaagaaccgt
gtggaaatcaatgatgtggagcccgaggtgttcaaggagatgatgtgcttcatctacacg
ggcaaagcccccaacctggacaagatggctgatgacctgctggctgcggctgacaagtat
gctctggagaggctgaaggtgatgtgtgaggatgctctatgcaccagtctgtctgtggag
aacactgcagagatcctcatcctggcagacctgcacagtgcagaccaactcaaaacacag
gctgtggacttcatcaactaccatgctgctgaggtgatggagacgtctggctggaagtcc
atggtagcatcccacccccacctggtggctgaggcctatcgctccttggcctcggcccag
tgccccttccttggacccccacgcaaacgcctcaaacagtcctag

KEGG   Salmo salar (Atlantic salmon): 106579088
Entry
106579088         CDS       T04363                                 

Definition
(RefSeq) speckle-type POZ protein
  KO
K10523  speckle-type POZ protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106579088
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     106579088
SSDB
Motif
Pfam: BTB MATH BACK
Other DBs
NCBI-GeneID: 106579088
NCBI-ProteinID: XP_014014110
UniProt: A0A1S3NFT5
LinkDB
Position
ssa19
AA seq 374 aa
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSG
ANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKAEVRAKFKFSILNAKGEETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK
VPDCRLADELGGLWENSRFTDCSLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNR
VEINDVEPEVFKEMMCFIYTDKAPNLDKMADDLLAAADKYALERLKVMCEDALCTSLSVE
NAAEILILADLHSADQLKTQAVDFINYHAAEVMETAGWKSMVASHPHLVAEAYRSLASAQ
CPFLGPPRKRLKQS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtcaagagtcccgagtccccctccccctgcggaaatgtccagcgggcctgtggcggag
agctggtgctacactcagatcaaagtggtaaagttctcctacatgtggaccatcaacaac
ttcagcttctgtcgcgaggagatgggcgaggtcattaagagctccaccttctcctcagga
gccaatgacaagctcaaatggtgtctgcgggtgaaccctaaagggctggatgaggagagc
aaagactacctgtccctctacttgctcctggttagctgtcccaaggctgaggtgcgtgcc
aagttcaagttctccatcctcaacgccaagggagaggagaccaaggccatggaaagccag
agagcatatcggtttgtccaggggaaggactggggctttaagaagttcatccgccgagac
ttcctgttggacgaggccaacggtcttctgcctgatgacaagctcaccttgttttgtgag
gtgagtgtggtgcaggactccgtgaacatctcgggtcagaacaccatgaacatggtgaag
gtgcctgactgcagactggctgatgagctgggtgggctgtgggagaactcgcgcttcacc
gactgctccctgtgtgtggccgggcaggagttccaggcccacaaagccatattagcagca
cgctctcctgtcttcagtgccatgtttgagcatgagatggaggagagcaaaaagaaccga
gtggagatcaatgacgtggagccagaggtcttcaaggagatgatgtgtttcatctacaca
gacaaggcccccaacttggacaagatggctgacgaccttctagcagccgctgacaagtat
gctcttgagaggctgaaggtgatgtgtgaggatgcactgtgcaccagtctgtctgtggag
aacgctgcagagatcctcatcctggcagacctgcacagcgccgaccagcttaaaacacag
gctgtggacttcatcaactaccatgctgccgaggttatggagacggcgggctggaagtcc
atggtggcatcccatcctcacctagtggccgaagcctaccgctcgctggcctcggcccag
tgccccttcctgggaccgccccggaaacgcctcaaacagtcttaa

KEGG   Salmo salar (Atlantic salmon): 106601600
Entry
106601600         CDS       T04363                                 

Definition
(RefSeq) speckle-type POZ protein
  KO
K10523  speckle-type POZ protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106601600
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     106601600
SSDB
Motif
Pfam: BTB MATH BACK
Other DBs
NCBI-GeneID: 106601600
NCBI-ProteinID: XP_014049407
UniProt: B5X432
LinkDB
Position
ssa03
AA seq 374 aa
MSRVPSPPPPADMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSG
ANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK
VPDCRLADELGGLWEHSRFTDCSLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNR
VEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCTSLSVE
NTAEILILADLHSADQLKTQAVDFINYHAAEVMETSGWKSMVASHPHLVAEAYRSLASAQ
CPFLGPPRKRLKQS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtcaagagtcccgagtccccctccccccgcggacatgtccagcggccctgtggctgag
agctggtgttacactcagattaaagtggtgaagttctcttacatgtggaccatcaacaac
ttcagcttctgtcgcgaggagatgggcgaggtcatcaagagctccaccttctcttcggga
gccaatgacaagcttaaatggtgtttacgtgtaaaccctaaaggcctggacgaggagagt
aaagactacctgtccctctacctgctcctggtcagctgtcccaagagcgaggtgcgtgcc
aagttcaagttctccatcctcaatgccaagggagaggagactaaggctatggagagccag
agggcataccggtttgtccaggggaaggactggggctttaagaaattcatcaggagagac
ttcctgctggacgaggccaatgggctgctgcctgacgacaagctcactctcttctgtgag
gtgagtgtggtgcaggactctgtgaacatctcaggacagaacactatgaacatggtgaag
gtgccagactgcaggctggccgatgagctgggagggctgtgggaacactcccgcttcact
gactgctccctgtgtgtggcgggacaggagttccaggcacacaaagccatcctggcagcc
cgatcgccagtgttcagtgccatgtttgagcatgagatggaggagagtaaaaagaaccgt
gtggagatcaacgatgtggagcccgaggtgttcaaggagatgatgtgcttcatctacacg
ggcaaagcccccaacctggacaagatggctgacgacctgctggctgcggctgacaagtat
gctctggagaggctgaaggtgatgtgtgaggatgctctatgcaccagtctgtctgtggag
aacactgcagagatcctcatcctggcagacctgcacagtgcagaccaactcaaaacacag
gctgtggacttcatcaactaccatgctgctgaggtgatggagacgtctggctggaagtcc
atggtggcatcccacccccacctggtggctgaggcctatcgctccttggcctcggcccag
tgccccttcctgggacccccacgcaaacgcctcaaacagtcctag

KEGG   Salmo salar (Atlantic salmon): 106601601
Entry
106601601         CDS       T04363                                 

Definition
(RefSeq) speckle-type POZ protein-like A
  KO
K10523  speckle-type POZ protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106601601
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     106601601
SSDB
Motif
Pfam: BTB MATH
Other DBs
NCBI-GeneID: 106601601
NCBI-ProteinID: XP_014049410
UniProt: A0A1S3RAM1
LinkDB
Position
ssa03
AA seq 359 aa
MWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCP
KSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDK
LTLFCEVSVVQDSVNISGQNTMNMVKVPDCRLADELGGLWEHSRFTDCSLCVAGQEFQAH
KAILAARSPVFSAMFEHEMEESKKNRVDISDVEPDVFKEMMGFIYTGKAPNLDKMADNLL
AAADKYALERLKVMCEEALCNSLSVENVADTLILADLHSAEQLKAQAIDFINRCSVLRQL
GCKDGKNWNSYNHATDIMETAGWKSMIQSHPHLVAEAFRALASAQCPPFGLPRKRLKQS
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgtggaccatcaacaacttcagcttctgtcgcgaggagatgggcgaggtcatcaagagc
tccaccttctcatcgggagccaatgacaagcttaaatggtgtttacgtgtaaaccctaaa
ggcctggacgaggagagtaaagactacctgtccctctacctgctcctggtcagctgtccc
aagagcgaggtgcgtgccaagttcaagttctccatcctcaatgccaagggagaggagact
aaggctatggagagccagagggcataccggtttgtccaggggaaggactggggctttaag
aaattcatcaggagagacttcctgctggacgaggccaatgggctgctgcctgacgacaag
ctcactctcttctgtgaggtgagtgtggtgcaggactctgtgaacatctcaggtcagaac
actatgaacatggtgaaggtgccagactgcaggctggccgatgagctgggagggctgtgg
gaacactcccgcttcactgactgctccctgtgtgtggcgggacaggagttccaggcacac
aaagccatcctggcagcccgatcgccagtgttcagtgccatgtttgagcatgagatggag
gagagtaaaaagaaccgtgtggacatcagtgatgtggagccagacgtgtttaaggagatg
atgggattcatctacacagggaaagctcccaacctggacaagatggccgacaacctgctg
gcagctgctgacaaatatgccttggagcgtttaaaggtgatgtgtgaagaggctctgtgc
aacagcctctctgtggagaacgtggctgataccctcatcctggcggatttacacagtgcc
gagcagctcaaagcacaagccatagattttatcaacaggtgcagtgtcctccgacagctg
ggctgtaaagatgggaaaaactggaatagttacaatcatgccacggacataatggagacg
gcaggctggaagtcaatgatccagtcccaccctcacttagtggccgaggccttcagagcc
ctggcatcggcacagtgcccgcccttcggcctgccgcggaaacgcctaaaacagtcctga

DBGET integrated database retrieval system