KEGG   Salmo salar (Atlantic salmon): 100195405
Entry
100195405         CDS       T04363                                 

Gene name
ccne2
Definition
(RefSeq) cyclin E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04110  Cell cycle
sasa04114  Oocyte meiosis
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100195405 (ccne2)
   04114 Oocyte meiosis
    100195405 (ccne2)
   04115 p53 signaling pathway
    100195405 (ccne2)
   04218 Cellular senescence
    100195405 (ccne2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sasa03032]
    100195405 (ccne2)
   03036 Chromosome and associated proteins [BR:sasa03036]
    100195405 (ccne2)
DNA replication proteins [BR:sasa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100195405 (ccne2)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100195405 (ccne2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100195405
NCBI-ProteinID: NP_001133906
UniProt: B5X486
LinkDB
Position
ssa02
AA seq 395 aa
MANVRRSGRITLQARDENAPEHNVKITRKRKSEPSKKMPPAVTKQSYEIQKRWSEEGASP
CVLVETPHKELVMTRDLSGFKQFRFKNIFIKTSPLPCLSWASSDDVWIKMLNKELKYVHD
KGFLQQHPKLKSKMRAILLDWLLEVSEVYTLHRETAYLAQDFFDRFMLTQDDMEKDRLQL
IGITALFIASKIEEIYPPKLHEFAYVTDGACEEEAILEMELVMLKALNWNLCPETVITWL
KLYAQVESLKDGVNFLVPQFSQDTYIQITQLLDLAMLDINSLDYQYGILAAAAFCHFFSF
DVVLKVSGLTWDNIAPCVRWMTPFMRTVSACPRAELKDFKKVTSDDRHNIQTHVDYLSML
SDAHQRQPDSQDRLSPAAIGGILTPPKSTEKPANH
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggctaacgttagacgcagtggtcgcatcacattacaggcaagagatgagaacgcaccg
gaacacaatgtcaagatcacacgaaaaagaaaatctgagccatcgaaaaagatgccaccc
gcagtgacgaaacaaagctatgaaatacagaaacggtggtcagaagaaggggcaagtcca
tgtgtccttgtagaaacgccacacaaggagctggtgatgaccagagacctgtctggcttc
aagcagttccgattcaagaacatcttcatcaagacctcaccgctgccctgcctcagctgg
gccagctcagatgacgtgtggattaagatgctgaacaaggagctgaagtatgtccatgac
aagggcttcctacagcagcaccccaaactaaagtccaagatgagggccattctcctggac
tggcttctagaggtgagtgaggtgtacactctgcatcgagagactgcttatctggctcag
gacttctttgaccgcttcatgctgactcaggacgatatggagaaggaccgactgcagctc
ataggaatcacagccctcttcatcgcatctaagatagaggaaatctaccctccaaagctc
catgagtttgcctatgttactgatggagcctgtgaggaagaagcgatcctggagatggaa
cttgtcatgttgaaggcgttgaactggaacctgtgtccagagacggtgatcacgtggctg
aagctctatgctcaggtggagtccctaaaggatggtgtcaacttcctggtacctcagttc
tctcaggacacctacatccagatcacacagcttttagacctggccatgctggacatcaac
tctctggactaccagtatgggatactggctgctgctgccttctgccattttttctcattt
gacgttgtcctcaaagtatcaggtctgacgtgggataatattgctccctgtgtccggtgg
atgacccccttcatgcgcacggtcagcgcctgtcccagagcagagctcaaggactttaag
aaagtgacgtctgatgacagacacaacatccagacccacgtagactacctgtccatgctg
agcgacgctcaccagaggcaaccggacagccaagacagactatcgcctgctgccatagga
gggatattaactccaccaaaaagcacagagaaaccagccaatcactga

KEGG   Salmo salar (Atlantic salmon): 106562012
Entry
106562012         CDS       T04363                                 

Definition
(RefSeq) G1/S-specific cyclin-E1-like
  KO
K06626  G1/S-specific cyclin-E1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04110  Cell cycle
sasa04114  Oocyte meiosis
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106562012
   04114 Oocyte meiosis
    106562012
   04115 p53 signaling pathway
    106562012
   04218 Cellular senescence
    106562012
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sasa03032]
    106562012
   03036 Chromosome and associated proteins [BR:sasa03036]
    106562012
DNA replication proteins [BR:sasa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    106562012
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    106562012
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 106562012
NCBI-ProteinID: XP_013982004
UniProt: A0A1S3KUL3
LinkDB
Position
ssa11
AA seq 410 aa
MPSKGENVESRTIDHEMPKDTSVRSKKRKSDVAVYLQDPDEVAEMTEKKQCGTLVCWNPE
SVHTIPCRRIPTPDNEVDPPVALNATGFSTQYTFKNIFVTPTRSSPLPVLCWASRDDVWN
NLLKKDETYSRDIHVMKKHPHLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDYFDRFMA
TQTNVFKCTLQLIGISSLFIAAKMEEIYPPKVHQFAYVTDGACTEDDILCMELIIMKELM
WRLSPLTPVSWLNIYMQVAYLKESEEVLIPQYPQTTFVQIAELLDLCVLDVKCLEFSYGV
LAASALFHFSSLELVEKVSALKWSDLEECVRWMVPFAMSIREVGSSALRTFKGIPADDMH
NIQTHAAYLDWMATACSYPQVDVDRSQSSPIPSGVLTPPPSSEKPEGTVS
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccaagcaaaggggaaaatgtggaatccaggacaattgatcatgagatgcccaaggac
acttcagtgagatccaagaaaagaaaatcagacgttgcggtttatttgcaagaccctgat
gaagtggcagagatgacggaaaagaaacagtgtggaactctagtgtgctggaatcctgag
tcggttcacacgatcccatgcaggcggatccccacgcctgacaatgaagtcgatccacca
gttgccttgaatgccactgggttttctactcagtacaccttcaaaaacatatttgtcacc
cccaccaggtcttcccctcttcctgtgctatgctgggcgagcagagacgacgtatggaac
aacctgttgaagaaagacgagacgtattctcgagacatccacgtcatgaagaaacaccca
cacctccaacccaagatgagggctattcttctcgactggctaatggaggtgtgcgaggtg
tacaagctacacagagaaaccttctacctggctcaggattactttgatcggttcatggcc
acacagaccaatgttttcaagtgtacactacaactcatcggtatctcttctctgtttata
gctgccaagatggaggaaatctaccctccaaaggtgcatcaatttgcctatgttactgat
ggtgcctgcactgaggatgatatcctttgtatggagctaatcattatgaaggagctgatg
tggcgtttaagtcccctgacgcctgtgtcctggctaaacatctacatgcaggttgcctac
ctgaaagagtccgaagaggttctcatcccacagtacccgcaaactacgtttgtgcagatt
gccgagctcctggacctctgtgtgttggatgtgaaatgtttggagttctcctacggtgtg
ctggctgcctctgccctgttccacttctcctcgctggagctggtggagaaagtctcagct
ctgaagtggtctgaccttgaggagtgtgtgaggtggatggtcccctttgccatgtccatc
agagaagtgggcagctcagccctgaggaccttcaaaggaatcccagcagatgacatgcat
aacatccagacccatgctgcctatctggactggatggcgacggcatgctcctacccacaa
gtggacgtagatcgcagccagagttcaccaataccgtccggagtgctcactccgcccccc
agcagcgagaaaccagagggcacagtctcttga

KEGG   Salmo salar (Atlantic salmon): 106605376
Entry
106605376         CDS       T04363                                 

Gene name
ccne2
Definition
(RefSeq) cyclin E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04110  Cell cycle
sasa04114  Oocyte meiosis
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106605376 (ccne2)
   04114 Oocyte meiosis
    106605376 (ccne2)
   04115 p53 signaling pathway
    106605376 (ccne2)
   04218 Cellular senescence
    106605376 (ccne2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sasa03032]
    106605376 (ccne2)
   03036 Chromosome and associated proteins [BR:sasa03036]
    106605376 (ccne2)
DNA replication proteins [BR:sasa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    106605376 (ccne2)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    106605376 (ccne2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 106605376
NCBI-ProteinID: XP_014056393
UniProt: A0A1S3RVT3
LinkDB
Position
ssa05
AA seq 420 aa
MARETGNVSKQWIIFGGTLKPSIDRMANVRRSGRITLKVRDENAPEENVKIRRKRKSEPS
KKMPPAAKKQSYEIQKRWSEEGASPCVLVETPHKELEMTRDRSGFKQFRFKNIFIKTSPL
PCLSWASSDDVWIKMLNKELKYVHDKGFLQQHPKLKPKMRAILLDWLLEVSEVYTLHRQT
AYLAQDFFDRFMLTQDDMEKDRLQLIGITALFIASKMEEIYPPKLHEFAYVTDGACEEEA
ILEMELVMLKALNWNLCPETVITWLKLYAQVESLKDGVNFLVPQFSQDTYIQITQLLDLA
ILDINSLDYQYGILAAAAFCHFFSFDVVHKVSGLTWDNIAPCVRWMTPFMRTVSACPRAE
LKDFKKVMSDDRHNIQTHVDYLVMLSNAHQRQPDSQDSLSPAAIGGILTPPKSTEKPANH
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggcaagagagactggtaacgttagcaaacaatggatcattttcggtggaactctgaag
ccttcaattgacagaatggctaacgttagacgcagtggtcgcatcacattgaaagtaaga
gatgagaacgcaccagaagagaatgtcaagatcagacgaaaaagaaaatctgagccatcc
aaaaagatgccacccgcagcgaagaaacaaagctatgaaatacagaaacggtggtcagaa
gaaggggcaagtccatgtgtcctcgtagaaacgccacacaaggagctggagatgacaagg
gaccggtctggcttcaagcagttccgattcaagaacatcttcatcaagacctcaccgctg
ccctgcctcagctgggccagctcagatgacgtgtggattaagatgctgaacaaggagctg
aagtatgtccatgacaagggcttcctacagcagcaccccaaactaaagcccaagatgagg
gccattctcctggactggcttctagaggtgagtgaggtgtacactctgcatcgacagact
gcttatctggctcaggacttctttgaccgcttcatgctgacacaggacgatatggagaag
gaccgactgcagctcataggcatcacagccctcttcatcgcgtctaagatggaggaaatc
taccctccaaagctccatgagtttgcctacgttactgacggagcctgtgaggaagaagcg
atcctggagatggaacttgtcatgttgaaggcgctgaactggaacctgtgtccagagacg
gtgatcacgtggctgaagctctatgctcaggtggagtccctaaaggatggcgtcaacttc
ctggtacctcagttctctcaggacacctacatccagatcacacagcttttagacttggcc
atactggacatcaactctctggactaccagtatgggatactggctgctgctgccttctgc
cattttttctcatttgacgtcgtccacaaagtatcaggtctgacgtgggataatattgct
ccctgtgtccggtggatgacccccttcatgcgcacggtcagcgcctgtcccagagcagag
ctcaaagactttaagaaggtgatgtctgacgacagacacaacatccagacccacgtagac
tacctggtcatgctgagcaacgctcaccagaggcaaccggacagccaagacagtctctcg
cctgctgccataggagggatattaactccaccaaaaagcacagagaaaccagccaatcac
tga

DBGET integrated database retrieval system