KEGG   Salmo salar (Atlantic salmon): 100195486
Entry
100195486         CDS       T04363                                 

Gene name
ccnd2
Definition
(RefSeq) G1/S-specific cyclin-D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100195486 (ccnd2)
   04340 Hedgehog signaling pathway
    100195486 (ccnd2)
   04068 FoxO signaling pathway
    100195486 (ccnd2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100195486 (ccnd2)
   04115 p53 signaling pathway
    100195486 (ccnd2)
   04218 Cellular senescence
    100195486 (ccnd2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100195486 (ccnd2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 100195486
NCBI-ProteinID: NP_001133987
UniProt: B5X4N6
LinkDB
Position
ssa07
AA seq 296 aa
MELICFEDKVVLAKIDPNILYDDRVLQSLLTIEDRFLPQCSYFKCVQKDIQPHMRRMVAG
WMHEVCEEEKSEEDVFPLAINYLDRFLAVEPTRKCYLQLLGAVCMFLATKLKESRPLTAE
KLCMYTDNSITPRELLEWELVVLGKLKWNMAAVIPNDFVDHILHRLPLPKEKLSVVRKHT
QTFIALCATDFSFAMNPPSMIATGSVGAAVCGLQLDQSDQALSRDRLTDLLAKITNTEVD
CLKACQEQIERVLASSLQQRQEALGRPGSKAMEQQDQSRTPTDVSSTPTDVRDVNL
NT seq 891 nt   +upstreamnt  +downstreamnt
atggaacttatttgcttcgaggacaaagtcgtgctagccaaaattgaccccaacattctc
tatgacgacagagtattgcaaagtctgctaaccattgaagacaggtttctaccgcaatgt
tcgtattttaaatgtgtccagaaggacattcagccacatatgaggcgaatggttgcagga
tggatgcacgaggtttgtgaagaggagaagagtgaggaagacgttttccccttggctatt
aattatttggacagatttttagcggtggagcccactagaaagtgttatttgcaacttcta
ggagctgtatgcatgttccttgcaacaaagttaaaggagagtcgtccattaactgcagaa
aagctgtgcatgtacacagacaattccatcacaccaagggagctgctggagtgggagttg
gtggttctagggaagttgaagtggaacatggcggcagtaatcccaaacgactttgtggat
cacatcctacacagactgcccctgcccaaagagaagctttctgtggtccgcaagcacaca
cagacattcatcgccctgtgtgccacagatttcagcttcgccatgaaccccccctccatg
atcgctacgggcagcgtgggggcggccgtctgcggcctgcagctggaccaatcagaccag
gccctgagtcgagaccgtctgactgacctgctggccaagatcaccaacacagaggtggac
tgtctgaaggcgtgtcaggagcagatagagagggtgttggccagtagcctgcagcagagg
caggaggccctaggcaggccgggcagcaaggccatggagcagcaagaccagtccagaacc
ccaacagacgtatccagcaccccaacagacgtacgcgacgtcaacctatga

KEGG   Salmo salar (Atlantic salmon): 100306852
Entry
100306852         CDS       T04363                                 

Gene name
ccnd1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100306852 (ccnd1)
   04340 Hedgehog signaling pathway
    100306852 (ccnd1)
   04371 Apelin signaling pathway
    100306852 (ccnd1)
   04068 FoxO signaling pathway
    100306852 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100306852 (ccnd1)
   04115 p53 signaling pathway
    100306852 (ccnd1)
   04218 Cellular senescence
    100306852 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100306852 (ccnd1)
   04530 Tight junction
    100306852 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100306852
NCBI-ProteinID: NP_001158863
UniProt: C0H9B3
LinkDB
Position
ssa16
AA seq 292 aa
MEHQLLCCEVETIRRAYQDSNLLNDRVLQTMLKAEDNYLPATNYFKCVQKEIVPCMRRIV
STWMLEVCEEQKCEEEVFPLAMNFLDRYLSVEPTKKTRLQLLGATCMFLASKMKETIPLT
AEKLCIYTDNSIRTGELLQMELLVLNKLKWDLASVTPHDFIDHFLSKLPIHQDTKQILCK
HAQTFVALCATDVKFIANPPSMIAAGSVAAAVQGLNLKSMDDALSSQQLTDFLSQVIRSD
PDCLRACQEQIESLLETSLRQAQQHTVSTDTKSMDEEVDLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacaccagttgctgtgctgtgaagtggagaccatccggagagcttaccaagactcg
aatctgctcaacgacagagttctgcagactatgctaaaagctgaagacaattatctcccc
gcaacgaactacttcaaatgtgtacagaaagagattgtaccctgcatgaggagaattgtt
tctacatggatgctggaggtctgtgaggaacagaaatgcgaagaggaggtttttccccta
gctatgaattttttagacagatatttgtctgttgaacccacgaagaagactcggctacag
ttattgggcgctacctgcatgtttctggcgtctaaaatgaaggagaccattcctctaaca
gctgagaagttgtgcatatacacagacaattccatccggacgggcgagttgctgcaaatg
gagctactggtattgaacaaactgaaatgggatctagcctcagttactccacacgatttc
atagaccacttcctctccaagctacccatccatcaggacaccaagcaaatcctgtgcaag
catgcccagacctttgtggctctctgtgctacagatgtcaaattcattgccaaccctccg
tcaatgatcgcagcgggcagtgtggcggctgctgtccaggggctgaatctgaagagcatg
gacgatgcactgtcatcccagcaactcactgacttcctgtctcaagtcatcagaagtgac
ccggattgtctacgggcgtgtcaagaacagatcgagtccttattggagaccagtctccgt
caggcacagcaacacactgtttccacggacaccaagagcatggatgaggaggtcgacctg
tcgtgcacgccaacggacgttagagatgtgaacatctga

KEGG   Salmo salar (Atlantic salmon): 106561356
Entry
106561356         CDS       T04363                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106561356
   04340 Hedgehog signaling pathway
    106561356
   04068 FoxO signaling pathway
    106561356
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106561356
   04115 p53 signaling pathway
    106561356
   04218 Cellular senescence
    106561356
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106561356
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Herp-Cyclin
Other DBs
NCBI-GeneID: 106561356
NCBI-ProteinID: XP_013980691
UniProt: A0A1S3KPQ1
LinkDB
Position
ssa10
AA seq 298 aa
MELLCLEMDTILRARPDPNILCDDRVLQSLLTIEERFIPQCSYFKCVQKDIQPFMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAVVPTRKCDLQLLGAVCMFLASKLKETRPLTA
DKLCIYTDNSIRPQELLEWELVVLGKLKWNLAAVTPNDFIEHIVRKLPLPEDKLTLIRKH
VQTFIALCATDFNFAMYPPSMIATGSVGAAICGLQLDSGDQSQWGDSLTDLLAKITNTEV
DCLKECQEQIERVLVSSLREGRQQQQQHQQQVQHGPSSKTMDELDQSSTPTDVRDINL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggagctgctttgcctcgaaatggacaccattttaagagctcgtcctgatccgaatatt
ctgtgtgatgatagggtattacaaagcctgttgaccattgaagaacgatttattccccaa
tgttcttatttcaagtgcgttcagaaagatattcagccatttatgcggaggatggttgct
acatggatgctggaggtttgtgaagaacagaagtgtgaggaagaggtttttcccttggca
atgaactacttagacagatttttagccgtggttccaaccagaaagtgtgatctgcaactt
cttggagcagtttgcatgttccttgcatccaaattgaaagaaactcgtccattaactgca
gacaaactctgcatctacactgataactccatcagaccacaggagctgctggagtgggag
ctggtggtgttggggaagttgaagtggaacctggcggctgtcacaccaaacgacttcatt
gaacacattgtgaggaagctgccgttgcccgaggacaagctgacgctgatacgtaaacat
gtgcagaccttcatcgccctctgcgccacagacttcaatttcgccatgtaccccccatcg
atgatcgccacgggcagtgttggagcggctatctgtgggcttcagttggactcgggtgac
cagtctcagtggggggacagtcttacagacctgctggccaaaatcacaaacacagaagtg
gactgtctgaaggagtgtcaggagcagattgagagggttttggtgagcagcctgcgcgag
gggcggcagcagcaacagcagcatcagcagcaggtccagcatggccccagcagtaagacc
atggacgagctggatcagtccagcaccccaacggacgttcgcgacatcaacttgtga

KEGG   Salmo salar (Atlantic salmon): 106561617
Entry
106561617         CDS       T04363                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K04503  G1/S-specific cyclin-D1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106561617
   04340 Hedgehog signaling pathway
    106561617
   04371 Apelin signaling pathway
    106561617
   04068 FoxO signaling pathway
    106561617
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106561617
   04115 p53 signaling pathway
    106561617
   04218 Cellular senescence
    106561617
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106561617
   04530 Tight junction
    106561617
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 106561617
NCBI-ProteinID: XP_013981218
UniProt: A0A1S3KR94
LinkDB
Position
ssa10
AA seq 291 aa
MEHQLLCCEVETIRRAYQDSNLLNDRVLQTMLKAEDSYLPATNYFKCVQKEIVPCMRRIV
STWMLEVCEEQKCEEEVFPLAMNFLDRYLSVEPTKKTRLQLLGATCMFLASKMKETIPLT
AEKLCIYTDNSIRPIDLLQMELLVLNKLKWDLASVTPHDFIDHFLSKLPIHQDTQQILRK
HAQTFVALCATDVKFIANPPSMIAAGSVAAAVQGLHLKMDDAMSSQQLTYFLSQVIRSDP
DCLRACQEQIESLLETSLRQAQQHTVSTDTKSMDEEVDLSCTPTDVRDVNI
NT seq 876 nt   +upstreamnt  +downstreamnt
atggaacatcagttgctgtgctgtgaagtggagaccatccggagagcttaccaagactcg
aacctgctcaacgatagagttttgcagaccatgctaaaagctgaagacagttatctccca
gcaacgaactacttcaaatgtgtacagaaagagattgtaccttgcatgaggagaattgtt
tctacatggatgctagaggtgtgtgaggaacagaaatgcgaagaggaggtttttcccctc
gctatgaattttttggacagatatttgtctgttgaaccgacaaagaagacccgactacaa
ttattgggagctacctgcatgtttctggcgtctaaaatgaaggagaccattcctctaacc
gcagagaagttgtgcatatacactgacaattccatccgaccaatcgatttgctgcaaatg
gaactactagtattgaacaaactgaaatgggatctagcctcagtgactccgcacgatttc
atagaccatttcctctccaaactacccatccatcaggacacccagcaaatcctgcgcaag
catgcccagacctttgtggccctctgtgctacagatgtcaaattcattgccaaccctccg
tcaatgatcgcagcgggcagtgtggcggctgctgtgcaggggttgcatctgaagatggac
gatgcaatgtcatcccagcaactgacttacttcctgtcccaagtcatcagaagtgacccg
gactgtctacgggcgtgtcaggaacagatcgagtccttattggagaccagtctccgtcag
gcacagcaacacactgtttccacggacaccaagagcatggatgaggaggtggacctctcg
tgcacgccaacggacgtgagagatgtgaacatctga

KEGG   Salmo salar (Atlantic salmon): 106562055
Entry
106562055         CDS       T04363                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K04503  G1/S-specific cyclin-D1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106562055
   04340 Hedgehog signaling pathway
    106562055
   04371 Apelin signaling pathway
    106562055
   04068 FoxO signaling pathway
    106562055
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106562055
   04115 p53 signaling pathway
    106562055
   04218 Cellular senescence
    106562055
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106562055
   04530 Tight junction
    106562055
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 106562055
NCBI-ProteinID: XP_013982074
UniProt: A0A1S3KUT6
LinkDB
Position
ssa11
AA seq 292 aa
MEHQLLCCEVETIRRAYQDANLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIIPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVELTNKTRLQLLGATCMFLASKMKETVPLT
ADKLCIYTDNSIRPSDLLQMELLTLNKLKWDLASVTPHDFIDHFLSKLPVHQNTKQILRK
HAQTFVALCATDVKFIANPPSMIAAGSVAAAVQGLYLKSKDGALSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQHNVSTETKRVDEDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacaccagctgttgtgctgtgaagtggaaaccatcagaagagcttaccaagatgca
aacttactaaatgaccgagttctacagacaatgctcaaagcagaggaaaattaccttccg
tctccaaattacttcaagtgtgtccagaaagaaataatacctaaaatgaggaaaattgtg
gctacatggatgttagaggtctgcgaggaacagaaatgcgaggaggaggtttttcccctg
gctatgaactacttggatagatttttgtctgtggagctcacaaataaaaccagattacaa
ctcctgggagctacttgtatgtttttggcctcaaagatgaaggaaacggtccctttaact
gcagataagttgtgcatttacaccgacaactccatccggcccagcgatctattgcaaatg
gaactactgactctaaacaagttgaaatgggatctagcatcggtaacaccacacgatttc
atagaccatttcctctccaagctaccagtccatcagaacacgaagcagattctgcgcaag
catgcccagacattcgtggctctctgtgcaacagatgtcaaattcattgccaaccctccc
tccatgatcgcagcgggcagtgtggcagcagcggtccaggggctgtacttaaagagcaaa
gatggtgcactgtcatctcagaacctaaccaactttctgtcccaagtcatcaggagtgac
ccggactgcctgaggtcatgtcaggaacagattgagtctctgcttgagtctagtctgaga
caggcacagcaacataatgtctccacagaaacaaaaagggtagatgaggatgtggacctg
tcctgcacccctacagatgtgagggacattaacatttga

KEGG   Salmo salar (Atlantic salmon): 106573197
Entry
106573197         CDS       T04363                                 

Gene name
CCND2
Definition
(RefSeq) G1/S-specific cyclin-D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106573197 (CCND2)
   04340 Hedgehog signaling pathway
    106573197 (CCND2)
   04068 FoxO signaling pathway
    106573197 (CCND2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106573197 (CCND2)
   04115 p53 signaling pathway
    106573197 (CCND2)
   04218 Cellular senescence
    106573197 (CCND2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106573197 (CCND2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Herp-Cyclin K-cyclin_vir_C
Other DBs
NCBI-GeneID: 106573197
NCBI-ProteinID: XP_014003457
UniProt: A0A1S3MJT5
LinkDB
Position
ssa16
AA seq 298 aa
MELLCLEMDTIIRASPDPNLLCDDRVLQSLLTIEERFLPQCSYFKCVQKDIQPFMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAVVPTRKCNLQLLGAVCMFLASKLKETRPLTA
EKLCIYTDNSIRPQELLEWELVVLGKLKWNLAAVTPNDFIEHIVRKLPLPEEKLVLIRKH
VQTFIALCATDFNFAMYPPSMIATGSVGAAICGLQLDSGDQSQWGDSLTDLLAKITNTEV
DCLKECQEQIERVLVSSLREGRQQQQQQQQQVQRGPSSKTMDELDQSSTPTDVRDINL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggagctgctttgcctcgaaatggacaccatcataagagctagtcctgatccgaatctc
ttgtgtgatgacagggtattacaaagcctgttgaccattgaagaacgttttcttccacaa
tgttcttatttcaagtgcgttcagaaagatattcagccatttatgaggaggatggttgcg
acttggatgctggaggtttgtgaagaacagaagtgtgaggaagaagtttttcccttggca
atgaactacttggacagatttttagccgtggttccaaccagaaagtgcaatctgcaactt
cttggagcagtttgcatgttccttgcatccaaactgaaagaaactcgtccattaactgca
gagaaactctgcatctacacagataactccatcagaccacaggagttgctggagtgggag
ctggtggtgctggggaagttgaagtggaacctggcggctgtcactccaaatgacttcata
gagcacattgtgaggaagctgccattgcccgaggagaagttagtgctgatacgcaaacac
gtgcagaccttcattgccctctgtgctacagacttcaacttcgcaatgtaccccccgtcc
atgatcgccactggcagtgtgggagcggctatctgtggcctccagttggactcgggtgac
cagtctcagtggggggacagtctcacagacctgctggccaaaatcaccaacactgaagtg
gactgtctgaaggagtgtcaggagcagattgagagggttttggtgagcagcctgcgcgag
gggcggcagcagcaacagcagcagcagcagcaggtccagcgtggccccagcagtaagacc
atggacgagctggatcagtccagcaccccaacggatgttcgcgacatcaacttgtga

KEGG   Salmo salar (Atlantic salmon): 106576262
Entry
106576262         CDS       T04363                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106576262
   04340 Hedgehog signaling pathway
    106576262
   04068 FoxO signaling pathway
    106576262
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106576262
   04115 p53 signaling pathway
    106576262
   04218 Cellular senescence
    106576262
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106576262
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 106576262
NCBI-ProteinID: XP_014008820
UniProt: A0A1S3N0I4
LinkDB
Position
ssa17
AA seq 301 aa
MELLCFEDKVVLAQIDPNILYDDRVLQSLLTIEDRFLPQCSYFKCVQKDIQPHMRRMVAG
WMHEVCEEEKSEEDVFPLAINYLDRFLAVAPTRKCYLQLLGAVCMFLATKLKESRPLTAE
KLCMYTDNSITPRDLLEWELVVLGKLKWNMAAVIPNDFVDHILHRLPLPKDKLSVVRKHT
QTFIALCATDFSFAMNPPSMIATGSVGAAVCGLQLDQSDQALSRDRLTDLLAKITNTEVD
CLKACQEQIERVLASSLQQEQQQQRQMAEGRPGSKAMEQQDQSRTPTDVSSTPTDVRDVN
L
NT seq 906 nt   +upstreamnt  +downstreamnt
atggaacttctttgcttcgaggacaaagtcgtgcttgcccaaattgaccccaacattctc
tatgacgacagagtattgcaaagtctgctaaccatagaagacaggtttctaccgcaatgt
tcgtattttaaatgtgtccagaaggacattcagccacatatgaggcgaatggttgcagga
tggatgcacgaggtttgtgaagaggagaagagtgaggaagacgttttccccttggctatt
aattatttggacagatttttagcggtggcgcccactagaaagtgttatttgcagcttcta
ggagctgtatgcatgttccttgcaacaaagttaaaggagagtcgtccattaactgctgaa
aagctgtgcatgtacacagacaactccatcacaccaagggatctgctggagtgggagttg
gtggtcctagggaagttgaagtggaacatggcggcagtcatcccaaacgactttgtggat
cacatcctacacagactgcccctgcccaaagataagctatctgtggtccgcaagcacaca
cagacattcatcgccctgtgtgccacagatttcagcttcgccatgaaccccccctccatg
atcgctacgggcagcgtgggggcggccgtctgcggcctgcagctggaccaatcagaccag
gccctgagtcgagaccgtctgactgacctgctggccaagatcaccaacacagaggtggac
tgtctgaaggcgtgtcaggagcagatagagagggtgttggccagtagcctgcagcaggag
caacagcagcagaggcagatggccgaaggcaggccgggcagcaaggccatggagcagcaa
gaccaatccagaaccccaacagacgtatccagcaccccaacagacgtacgcgacgtcaac
ctatga

KEGG   Salmo salar (Atlantic salmon): 106587137
Entry
106587137         CDS       T04363                                 

Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106587137
   04340 Hedgehog signaling pathway
    106587137
   04371 Apelin signaling pathway
    106587137
   04068 FoxO signaling pathway
    106587137
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106587137
   04115 p53 signaling pathway
    106587137
   04218 Cellular senescence
    106587137
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106587137
   04530 Tight junction
    106587137
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 106587137
NCBI-ProteinID: XP_014030658
UniProt: A0A1S3PSJ3
LinkDB
Position
ssa26
AA seq 292 aa
MEHQLLCCEVETIRRAYQDANLLNDRVLQTMLKAEENYLPSPNYFKCVQKEIIPKMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPTNKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSIRPSDLLQMELLTLNKLKWDLASVTPHDFIDHFLSKLPIHQNTKQILRK
HAQTFVALCATDVKFIANPPSMIAAGSVAAAVQGLYLKSKDGALSSQNLTDFLSQVIRSD
PDCLKSCQEQIESLLESSLRQAQQHNVSTETKRVEEDVDLSCTPTDVRDINI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacaccagctgttgtgctgtgaagtggaaaccatcagaagagcttaccaagacgcc
aacttactaaatgaccgagttctacagacaatgctcaaagcagaggaaaattaccttccg
tctccgaattacttcaagtgtgtccagaaagaaataatacctaaaatgaggaaaattgtg
gctacatggatgttagaggtctgcgaggaacagaaatgcgaggaggaggtttttcccctg
gctatgaactacttggatagatttttgtctgtggagcccacaaataaaaccagattacaa
ctcctgggagctacttgtatgtttttggcctcaaagatgaaggaaacggtccctttaact
gcagagaagttgtgcatttacaccgacaactccatccggcccagcgatctattgcaaatg
gaactactgactctaaacaagttgaagtgggatctagcatcggtaacacctcacgatttc
atagaccatttcctctccaagctaccaatccatcagaacacgaagcagattctgcgcaag
catgcccagacattcgtggctctctgtgcaacagatgtcaaattcatcgccaaccctccc
tccatgatcgcagcgggcagtgtggcagcagcggtccaggggctgtacctaaagagcaaa
gatggtgcactgtcatcccagaacctaactgactttctgtcccaagtcatcaggagtgac
ccggactgcctgaagtcgtgtcaggaacagattgagtctctgcttgagtctagtctgaga
caggcacagcaacataatgtctccacagaaacaaaaagggtagaggaggatgtggacctg
tcctgcacccctacagacgtgagggacattaacatttga

KEGG   Salmo salar (Atlantic salmon): 106601568
Entry
106601568         CDS       T04363                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106601568
   04340 Hedgehog signaling pathway
    106601568
   04068 FoxO signaling pathway
    106601568
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106601568
   04115 p53 signaling pathway
    106601568
   04218 Cellular senescence
    106601568
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106601568
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 106601568
NCBI-ProteinID: XP_014049353
UniProt: A0A1S3RAG1
LinkDB
Position
ssa03
AA seq 310 aa
MSVSVSLWCEEEVRGQQGQEAQQGQARGQSQLRAPWDPSVSGQRIIQRLLQVEERYLPSA
LYVALIQREPERREELTKWAMEVCCECGCDETVFPLSVSMLDRFLSASLSFPVSPYCLAA
ACILIASKLTECDTISADSLCAAAEYSFLPSNIREMERVILATLRWDVAAVTPQDFIPHF
LPPVGERKDGKTDTEEFFSTLRRHSDTLVAMCVCDYRFLGAPPSLVAAAALNSALRGLGN
KGPGHLGHMSATLAELCQTDLMVLQCYSELIEAALKQRLRGGLQDNAMEKDGEIEDERAG
TPTDMREIDF
NT seq 933 nt   +upstreamnt  +downstreamnt
atgtctgtgtctgtgtctctgtggtgtgaggaggaagtccgaggccaacaaggccaggaa
gcccagcagggccaggccaggggccagtcacagctccgggccccctgggaccccagtgtg
tctgggcagcggatcatccagaggctgctacaggtggaggagagatatctgccctccgcc
ctctacgtcgccctcatccagagagagccggagcgcagagaggagctcaccaagtgggct
atggaagtatgctgtgagtgtggctgtgacgaaacagtgtttcccctgtctgtctctatg
ttggaccgcttcctatctgcctccctgtcttttcctgtctcaccctactgcctggctgca
gcctgcatcctcatcgcctccaaactaacagagtgtgacacaatctctgctgactctctt
tgtgctgcagctgagtacagcttcctgccctccaacatacgggagatggaacgtgtcatc
cttgcgactcttcgatgggacgttgctgcggtaacccctcaggacttcattccacatttc
cttccccctgtaggggagaggaaggatggaaagacagacacagaggagttcttctccaca
ctgcgtcggcatagtgacaccctggttgccatgtgtgtctgcgactaccgtttcctggga
gcccctccatccctggttgctgcggcagcgctgaactctgccctccgggggttgggcaac
aagggtccaggtcatctgggtcatatgagtgctacactggcagaactgtgtcagactgac
ctgatggtgttgcagtgttacagtgaattgatagaagctgccctcaaacaacggctcaga
ggtggactccaagacaatgccatggagaaggatggagaaatagaggatgaaagagcaggc
actcctactgatatgagagagattgatttctaa

KEGG   Salmo salar (Atlantic salmon): 106606904
Entry
106606904         CDS       T04363                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106606904
   04340 Hedgehog signaling pathway
    106606904
   04068 FoxO signaling pathway
    106606904
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106606904
   04115 p53 signaling pathway
    106606904
   04218 Cellular senescence
    106606904
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106606904
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C EF-hand_1
Other DBs
NCBI-GeneID: 106606904
NCBI-ProteinID: XP_014058841
UniProt: A0A1S3S387
LinkDB
Position
ssa06
AA seq 307 aa
MSVSVSLWCEEEVQGQGAQQGQARGQSQLRAPWDPSVSGQRIIQRLLQVEERYLPSALYV
ALIQREPERREELAKWAMEVCCECGCDETVFPLSVSMLDRFLSASLSLPVSPYCLAAACI
LIASKLTECDTISADSLCAAAEYSFLPSNIREMERVILATLRWDVAAVTPQDFIPHFLPP
VGERKDGKIDTEEFFSTLRRHSDTLVAMCVCDYRFLGAPPSLVAAAALNSALRGLGNKGP
GHLGHMSATLAELCQTDLMVLQCYSELIEAALKQRLRGGLQDSAMEKDGEIEDERAGTPT
DMREIDF
NT seq 924 nt   +upstreamnt  +downstreamnt
atgtctgtttctgtgtctctgtggtgtgaggaggaagtccaaggccagggagcccagcag
ggccaggccaggggccagtcacagctccgggccccctgggaccccagtgtgtctgggcag
cggatcatccagaggctgctacaggtggaggagagatatctgccctccgccctctacgtc
gccctcatccagagagagccggagcgcagagaggagctcgccaagtgggctatggaagta
tgctgtgagtgtggctgtgacgaaacagtgtttcccctgtctgtctctatgttggaccgc
ttcctgtctgcctccctgtctctccctgtctcaccctactgcctggctgcagcctgcatc
ctcatcgcctccaaactaacagagtgtgacacaatctctgctgactctctttgtgctgca
gctgagtacagcttcctgccctccaacatacgggagatggaacgtgtcatccttgcgact
cttcgatgggacgttgctgcggtaacccctcaggacttcattccacatttccttccccct
gtaggggagaggaaggatggaaagatagacacagaggagttcttctccacactgcgtcgg
catagtgacaccctggttgccatgtgtgtctgcgactaccgtttcctgggagcccctcca
tccctggttgctgcggcagcgctgaactctgccctccgggggttgggcaacaagggtcca
ggtcatctgggtcatatgagtgctacactggcagaactgtgtcagactgacctgatggtg
ttgcagtgttacagtgaattgatagaagctgccctcaaacaacggctcagaggtggactc
caagacagtgccatggagaaggatggagaaatagaggatgaaagagcaggcactcctact
gatatgagagagattgatttctaa

DBGET integrated database retrieval system