KEGG   Salmo salar (Atlantic salmon): 100195746
Entry
100195746         CDS       T04363                                 

Gene name
cd37
Definition
(RefSeq) Leukocyte antigen CD37
  KO
K06509  CD82 antigen
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100195746 (cd37)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    100195746 (cd37)
   04090 CD molecules [BR:sasa04090]
    100195746 (cd37)
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100195746 (cd37)
  Exosomal proteins of other body fluids (saliva and urine)
   100195746 (cd37)
  Exosomal proteins of colorectal cancer cells
   100195746 (cd37)
CD molecules [BR:sasa04090]
 Proteins
  100195746 (cd37)
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 100195746
NCBI-ProteinID: NP_001134247
UniProt: B5X7F8
LinkDB
Position
ssa19
AA seq 256 aa
MASQGCIGLIKYFLFLFNLLFSCVGALLLSLGIWIVLAETSFFMPAPPYMSFSVFSYFLV
IGGSATMSLGFIGCLGALKEVKCMLGMYFFLLSILLAAQIVGAVLLFTQRTSFESKVEEH
VLHLIASFGKNESNYLNLEKTLDYVQQEIHCCGWTGPNIWVKAPCSCYHPINNTQNDSNS
YEMCDCNDIRSFSNYTMCDIYQNGCRESIREWLDENMLIIFAVLLAVMTVELCGMTLSMC
LYRWTSLDYSMLMQYS
NT seq 771 nt   +upstreamnt  +downstreamnt
atggcatcccaaggctgtattggtctcatcaaatatttcctattccttttcaatctactt
ttttcttgtgtgggcgccctcctgctgtcacttgggatatggatagtccttgctgagaca
agcttcttcatgcctgcccctccctatatgtctttttctgtgttctcctatttcctggtc
attggtggaagtgctacgatgtcgttgggcttcattgggtgtctgggtgcattgaaggag
gtgaaatgcatgttaggaatgtatttcttcctgctctccatccttcttgctgctcagatt
gtgggagcggttctgctcttcactcagaggacttcatttgaaagcaaagtcgaagagcat
gttcttcatctcattgcatcatttggcaagaatgaatccaactatctgaatttggaaaag
actctggactacgttcagcaggagattcattgttgtggatggacaggaccaaacatctgg
gtgaaggcaccctgctcctgttaccaccccatcaataacacccagaatgactcaaattct
tatgaaatgtgtgactgcaatgacatccggtctttttcaaattacacaatgtgtgacatc
tatcaaaacgggtgcagagagagtattagagagtggttggacgagaatatgctcattatt
tttgccgtgctacttgctgtgatgacggtggagctatgtggtatgaccctttcgatgtgt
ctgtatagatggaccagcctggattacagcatgctgatgcaatactcataa

KEGG   Salmo salar (Atlantic salmon): 100195962
Entry
100195962         CDS       T04363                                 

Gene name
cd82
Definition
(RefSeq) CD82 antigen
  KO
K06509  CD82 antigen
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100195962 (cd82)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    100195962 (cd82)
   04090 CD molecules [BR:sasa04090]
    100195962 (cd82)
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100195962 (cd82)
  Exosomal proteins of other body fluids (saliva and urine)
   100195962 (cd82)
  Exosomal proteins of colorectal cancer cells
   100195962 (cd82)
CD molecules [BR:sasa04090]
 Proteins
  100195962 (cd82)
SSDB
Motif
Pfam: Tetraspanin DUF1310 DUF4229
Other DBs
NCBI-GeneID: 100195962
NCBI-ProteinID: NP_001134463
UniProt: B5X9W4
LinkDB
Position
ssa10
AA seq 256 aa
MGKGCITATKYFLFLFNPIFFIFGALIMSFGLWVLLDNQSFIAVLQESSTTLKVASYILI
TVGSLSMVMGFLGCIGAIYGIRCLLGLYFTCLLLILIAQVTAGVLIYFQRDRLQQEMSTI
VKGMLVNYTGQNRTTEHSWDYVQRTMKCCGWVGPSNWLENVWIRNSSVSLYPCSCRNETL
PGTDMIETGLCEHLSADLPVYQTGCMHSVEGWLLENYGVILGICVGVAVLELLGMILSMC
LCKSVVQEDYTKVPKY
NT seq 771 nt   +upstreamnt  +downstreamnt
atggggaagggatgcatcacagcaaccaagtacttcctgttcctgttcaaccccatcttc
ttcatctttggagcgttgatcatgagctttggactgtgggtccttctggataaccagagc
ttcatcgctgttctacaggagtcctccaccactctgaaagtggcgtcctatattctgatc
accgtgggttctctctccatggttatgggcttcctgggctgtataggagccatctacggg
atacgctgcctgctgggcctgtacttcacttgcctcctgctcatcctcatcgcccaggtt
acggctggcgtactcatctacttccagagagacaggctgcagcaggagatgtccaccatc
gtcaaggggatgctggtcaactacacgggtcagaacaggaccacagaacattcctgggac
tatgtacagaggacgatgaagtgttgtggttgggtgggtccaagtaactggttggagaac
gtgtggattcggaacagttctgtctccctgtacccctgctcctgtcggaatgaaaccctg
cctgggacagacatgatagagactgggctctgtgaacacttgtctgctgacctgccagta
taccaaacgggctgcatgcatagtgtggagggctggctgttggagaactatggagttatt
cttggaatctgtgtcggggtggcagtcctagagctcctagggatgattctgtccatgtgt
ctctgtaagagtgttgtccaagaggattacaccaaagttcccaagtactga

KEGG   Salmo salar (Atlantic salmon): 106572911
Entry
106572911         CDS       T04363                                 

Definition
(RefSeq) CD82 antigen-like
  KO
K06509  CD82 antigen
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106572911
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106572911
   04090 CD molecules [BR:sasa04090]
    106572911
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106572911
  Exosomal proteins of other body fluids (saliva and urine)
   106572911
  Exosomal proteins of colorectal cancer cells
   106572911
CD molecules [BR:sasa04090]
 Proteins
  106572911
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 106572911
NCBI-ProteinID: XP_014002971
UniProt: A0A1S3MJB7
LinkDB
Position
ssa15
AA seq 141 aa
MSNIVTQILSNYPGKNSTTEQAWDYIQRTMECCGWSGRMDWHGNAVIVNSSQLLFPCSCQ
NVSLVESDSSSDSGFCEAQSLDWPVYDRGCNSSVESWLFANVGVILGVCLGVAVIELLGM
ILSIGLCKSIHTEDYTKVPKY
NT seq 426 nt   +upstreamnt  +downstreamnt
atgtccaacatcgtgacccagatcctaagcaactaccctggcaagaacagcaccacagag
caggcctgggattacatacagaggacgatggagtgttgtggatggagtggtcgtatggac
tggcatggtaatgctgtcatagtgaacagttcccagctgttgttcccgtgttcctgccag
aacgtgtctttggttgagagtgattcctcctctgacagtggtttctgtgaggcacagtca
cttgactggcccgtctacgacaggggctgtaactccagtgtagagagctggctgtttgcc
aacgttggagtgatcctgggggtctgcctgggagtggctgtcatcgagctcctgggtatg
atcctgtccatagggctgtgtaagagcatacacactgaggattacaccaaagtgccaaag
tactga

KEGG   Salmo salar (Atlantic salmon): 106573025
Entry
106573025         CDS       T04363                                 

Definition
(RefSeq) CD82 antigen-like
  KO
K06509  CD82 antigen
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106573025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106573025
   04090 CD molecules [BR:sasa04090]
    106573025
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106573025
  Exosomal proteins of other body fluids (saliva and urine)
   106573025
  Exosomal proteins of colorectal cancer cells
   106573025
CD molecules [BR:sasa04090]
 Proteins
  106573025
SSDB
Motif
Pfam: Tetraspanin DUF1310
Other DBs
NCBI-GeneID: 106573025
NCBI-ProteinID: XP_014003100
UniProt: A0A1S3MJ32
LinkDB
Position
ssa16
AA seq 264 aa
MFSCRVVTMGKGCITATKYFLFLFNLLFFIFGALIMGFGLWVLLDNQSFIAVLQESSTTL
KVVSYIFISVGSLSMAMGFLGCIGAIYEIRCLLGLYFTCLLLILIAQVTAGVLIYFQRDR
LKHEMSNIIKGMLVNYTGQNRTTEHTWDYVQRTMKCCGWTGPGNWSENVWIRNSSVSMYP
CSCRNETLPGTDVKETGLCEHLSNDLPVYEKGCMHSVEGWLLENCGVILGICVGVAVIEL
LGMILSMCLCKSVVQEDYTKVPKY
NT seq 795 nt   +upstreamnt  +downstreamnt
atgttcagttgcagagtcgtaaccatggggaagggatgcatcacagcaactaagtacttc
ctgttcctcttcaacctcctcttctttatctttggagcattgatcatgggctttggactg
tgggttctcctggataaccagagcttcatcgcagttctgcaggaatcctctaccaccctg
aaggtagtgtcctacattttcatcagtgtggggtctctctccatggccatgggcttcctg
ggctgtataggagccatctatgagatacgctgcctgctgggcctgtacttcacctgcctc
ctgctcatcctcattgcccaggtaaccgctggggtgctcatctactttcagagagaccgg
ctgaagcatgagatgtccaacatcatcaaggggatgttggtcaactacactggtcagaac
aggaccacagaacacacctgggactatgtacagaggacgatgaagtgctgtggttggact
ggcccaggcaactggtcggagaatgtatggatcaggaacagttctgtctccatgtacccc
tgctcctgtcggaacgaaaccctgcccgggactgatgtcaaggagacagggctctgtgaa
cacttgtccaacgacctgccggtctacgaaaagggctgcatgcatagtgtggagggctgg
cttctggagaactgtggagttattcttggaatctgtgttggagtggcagtcattgagctt
ctgggaatgatcctgtctatgtgcctgtgtaagagtgttgtccaggaggactacaccaaa
gtacccaagtactga

KEGG   Salmo salar (Atlantic salmon): 106587947
Entry
106587947         CDS       T04363                                 

Definition
(RefSeq) CD82 antigen-like
  KO
K06509  CD82 antigen
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106587947
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106587947
   04090 CD molecules [BR:sasa04090]
    106587947
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106587947
  Exosomal proteins of other body fluids (saliva and urine)
   106587947
  Exosomal proteins of colorectal cancer cells
   106587947
CD molecules [BR:sasa04090]
 Proteins
  106587947
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 106587947
NCBI-ProteinID: XP_014032084
UniProt: A0A1S3PY01
LinkDB
Position
ssa26
AA seq 257 aa
MGKGCMKAIKYFLFLFNVLFFLFGALIMGFGLWVLLDNESFMVILQESSTVLKIASYILI
GVGGLSMLMGFLGCLGAIYEIRCLLGLYFTCLLLILIGQVAAGVLIYFQKDLLNKEMSNI
VTQILSNYPGKNSTTEQAWDYIQRTMECCGWSGHMDWHGNAVVVNSSQLLFPCSCQNVSL
VEGDSSSDSGFCEAQSLHWPVYNRGCNSSVESWLFANVGVILGVCLGVAVIELLGMILSI
GLCKSIHTEDYTKVPKY
NT seq 774 nt   +upstreamnt  +downstreamnt
atggggaaaggctgcatgaaggcaatcaagtacttcctgttcctcttcaatgtcctcttc
ttcctgtttggcgccctcatcatggggttcggactgtgggtccttctggacaatgagagc
ttcatggtcatcctgcaagagtcctccacagtgctgaagatagcttcctacatcctgata
ggtgtaggtggtctctccatgttgatgggcttcctgggttgcctgggggctatctacgag
atccgctgtctgctgggcctgtacttcacctgcctgctgctgattctgattggtcaggtg
gcagccggtgtactcatctacttccagaaggacctgctaaataaggagatgtccaacatc
gtgacccagatcctaagcaactaccctggaaagaacagcaccacagagcaggcctgggat
tatatacagaggacgatggagtgttgtggatggagtggtcatatggactggcatggtaat
gctgtcgtagtgaacagttcccagctgttgttcccgtgttcctgccagaacgtgtctctg
gttgagggtgattcctcctctgacagtggtttctgtgaggcacagtcacttcactggccc
gtctacaacaggggctgtaactccagtgtagagagctggctgtttgccaacgttggagtg
atcctgggggtctgcctgggagtggccgtcatcgagctcctgggtatgatcctgtccata
gggctgtgtaagagcatacacactgaggattacaccaaagtgccaaagtactga

KEGG   Salmo salar (Atlantic salmon): 106587984
Entry
106587984         CDS       T04363                                 

Definition
(RefSeq) CD82 antigen-like
  KO
K06509  CD82 antigen
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106587984
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106587984
   04090 CD molecules [BR:sasa04090]
    106587984
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106587984
  Exosomal proteins of other body fluids (saliva and urine)
   106587984
  Exosomal proteins of colorectal cancer cells
   106587984
CD molecules [BR:sasa04090]
 Proteins
  106587984
SSDB
Motif
Pfam: Tetraspanin TMEM171
Other DBs
NCBI-GeneID: 106587984
NCBI-ProteinID: XP_014032119
UniProt: A0A1S3PWP5
LinkDB
Position
ssa26
AA seq 135 aa
MGKGCMKAIKYFLFLFNVLFFLFGALIMGFGLWVLLDNESFMVILQESSTVLKIASYILI
GVGGLSMLMGFLGCLGAIYEIRCLLGLYFTCLLLILIGQVAAGVLIYFQKDLVSDVTSCL
HLLVAFRKEKLTECS
NT seq 408 nt   +upstreamnt  +downstreamnt
atggggaaaggctgcatgaaggcaatcaagtacttcctgttcctcttcaatgtcctcttc
ttcctgtttggcgccctcatcatggggttcggactgtgggtccttctggacaatgagagc
ttcatggtcatcctgcaagagtcctccacagtgctgaagatagcttcctacatcctgata
ggtgtaggtggtctctccatgttgatgggcttcctgggctgcctgggggctatctacgag
atccgctgtctgctgggcctgtacttcacatgcctgctgctgattctgattggtcaggtg
gcagccggtgtactcatctacttccagaaggacctggtgagtgatgtcacttcctgttta
cacctgttggtcgcgttcaggaaagagaaacttactgaatgtagctga

DBGET integrated database retrieval system