KEGG   Salmo salar (Atlantic salmon): 100196057
Entry
100196057         CDS       T04363                                 

Gene name
bclx
Definition
(RefSeq) Apoptosis regulator Bcl-X
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04210  Apoptosis
sasa04621  NOD-like receptor signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100196057 (bclx)
   04137 Mitophagy - animal
    100196057 (bclx)
  09143 Cell growth and death
   04210 Apoptosis
    100196057 (bclx)
   04115 p53 signaling pathway
    100196057 (bclx)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100196057 (bclx)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100196057 (bclx)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    100196057 (bclx)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    100196057 (bclx)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sasa02000]
    100196057 (bclx)
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100196057 (bclx)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100196057 (bclx)
Transporters [BR:sasa02000]
 Other transporters
  Pores ion channels [TC:1]
   100196057 (bclx)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 100196057
NCBI-ProteinID: NP_001134558
UniProt: B5XAY3
LinkDB
Position
ssa13
AA seq 228 aa
MMTYNNRELVVYYITYKLSQRDYPFNHMELTEAQNRTEVGQVEGGAAVLTYVNGTSPGTP
PPRQSPPSSPRRTAGLDAVKEALRDSANEFELRYARAFSDLSSQLHITPSTAYQSFENVM
DEVFRDGVNWGRVVGLFSFGGALCVECVDKEMNPLVGRITDWMTVYLDNHIQPWIQSQGG
WDRFAEIFGMDAAAESRKSQESFKKWLLAGMTLVTGVVVGSLFAQKRL
NT seq 687 nt   +upstreamnt  +downstreamnt
atgatgacttacaacaacagagaactggtggtgtactatattacctataaactatcacag
agggactaccccttcaaccacatggagctcacggaagcccagaatcggactgaggtggga
caggtggaagggggtgcggcagtcctaacatacgtcaacgggacgagtcccgggactcca
ccaccacggcagtcgcccccctcctcccctcggcggacagcgggcctggacgcagtgaaa
gaggcattgcgggactctgccaacgagtttgagctgcgttatgccagagcgttcagtgac
ctgtcctcccagctacacatcacgccgtccacagcctaccagagctttgagaacgtgatg
gacgaggtgttccgggacggtgtcaactggggacgggtggtgggcctgttttccttcgga
ggggccctctgtgtagaatgtgtggacaaggagatgaaccccttggtgggaaggatcaca
gactggatgaccgtctacctggacaaccacatccagccctggatccagagccaaggagga
tgggaccggtttgcagagatctttggaatggacgctgcagccgagagcaggaagtctcag
gagagctttaagaagtggcttctggcagggatgaccctggtcacaggagtcgtcgtaggg
tcactcttcgctcagaaacgcctgtga

KEGG   Salmo salar (Atlantic salmon): 106565774
Entry
106565774         CDS       T04363                                 

Gene name
BCLX
Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04210  Apoptosis
sasa04621  NOD-like receptor signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106565774 (BCLX)
   04137 Mitophagy - animal
    106565774 (BCLX)
  09143 Cell growth and death
   04210 Apoptosis
    106565774 (BCLX)
   04115 p53 signaling pathway
    106565774 (BCLX)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106565774 (BCLX)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106565774 (BCLX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    106565774 (BCLX)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106565774 (BCLX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sasa02000]
    106565774 (BCLX)
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106565774 (BCLX)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106565774 (BCLX)
Transporters [BR:sasa02000]
 Other transporters
  Pores ion channels [TC:1]
   106565774 (BCLX)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 106565774
NCBI-ProteinID: XP_013988754
UniProt: C0HAD8
LinkDB
Position
ssa12
AA seq 216 aa
MSYSNRELVVFFISYRLSQRNYSCCQLGLEGASGRTEGDDAIANGSVGNSRSNLAKPSSP
QGGMEPVKAALRDSVDEFELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVNWGR
VVGLFAFGGALCVECVEKDMSPLVARIADWMTTYLDNHIQPWIQSQGGWDRFAEIFGRDA
AADVRRSQESIIKWLLVGVILLSGVLVGTLIMKKRQ
NT seq 651 nt   +upstreamnt  +downstreamnt
atgtcttacagtaacagggaactggtggtgttttttataagctatagactgtcccagagg
aattattcatgttgtcaattggggctggagggtgcaagtggacggactgagggagatgac
gccattgcaaatgggtctgtggggaacagcagaagcaatttggcgaagccctcatctcca
caggggggcatggagccagtgaaagcagcactacgggactcagtggatgagtttgagctg
cgctacacccgcgccttcagtgacctctcctcccagctccacatcacccctgccacagcc
taccacagctttgagagtgtgatggacgaagtgttcagggacggggtcaactggggtcgc
gtggtgggtctgtttgctttcggcggggccttgtgtgttgagtgtgttgagaaggatatg
agcccactggtggcgcgcatcgcagactggatgaccacctacctggacaaccatatccag
ccctggatccagagccaaggaggatgggaccgttttgcagagatctttggcagagatgct
gctgcagacgttcgacggtctcaggagagcataattaaatggctgctagttggggtgatt
ctgctttcaggagtgctggtcggcactctcatcatgaagaaacgccagtga

KEGG   Salmo salar (Atlantic salmon): 106572112
Entry
106572112         CDS       T04363                                 

Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04210  Apoptosis
sasa04621  NOD-like receptor signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106572112
   04137 Mitophagy - animal
    106572112
  09143 Cell growth and death
   04210 Apoptosis
    106572112
   04115 p53 signaling pathway
    106572112
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106572112
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106572112
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    106572112
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106572112
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sasa02000]
    106572112
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106572112
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106572112
Transporters [BR:sasa02000]
 Other transporters
  Pores ion channels [TC:1]
   106572112
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 106572112
NCBI-ProteinID: XP_014001438
UniProt: A0A1S3MED7
LinkDB
Position
ssa15
AA seq 230 aa
MTYNNRELVVYYITYKLSQRDYPFNHIGLTEAPSRTEGGQAEGGAAVTTHPNGAANGTSP
GTPPRQSPPSSPQRTMGLDAVKEALRDSANEFELRYARAFSDLSSQLHITPATAYQSFEN
VMDEVFRDGVNWGRVVGLFAFGGALCVECVEKEMSPLVGRIADWMTVYLDNHIQPWIQSQ
GGWDRFAEIFGKDAAAESRKSQENFKKWLLAGMTLVTGVIVGSLIAQKRL
NT seq 693 nt   +upstreamnt  +downstreamnt
atgacttacaacaacagagaactggtggtatactatattacctataaactatcacagaga
gactaccccttcaaccacattgggctcacagaagctcccagtcggactgaggggggacag
gcggaagggggggcggcagtcacgacacaccccaacggcgcagcgaacgggacgagtcct
gggactccaccgcgacagtctcccccctcgtcccctcagcggacaatgggcctggacgca
gtgaaagaggcattgcgggactctgccaacgagtttgagctgcgttatgccagagcgttc
agtgacctgtcctcccagctgcacatcacgccggccacagcctaccagagcttcgagaac
gtgatggatgaggttttccgtgacggtgtgaactggggacgtgtggtgggcctgtttgcc
ttcggaggggccctctgtgtagagtgtgtggagaaggagatgagcccactagtgggacgg
attgcagactggatgactgtctacctggacaaccacatccaaccctggatccagagccaa
ggaggatgggaccggtttgcagaaatctttgggaaggacgctgcagctgagagcaggaag
tctcaggagaactttaagaagtggttgctggcggggatgacgctggttacaggagtcatc
gtagggtcactcattgctcagaaacgcctgtga

KEGG   Salmo salar (Atlantic salmon): 106582883
Entry
106582883         CDS       T04363                                 

Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04210  Apoptosis
sasa04621  NOD-like receptor signaling pathway
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106582883
   04137 Mitophagy - animal
    106582883
  09143 Cell growth and death
   04210 Apoptosis
    106582883
   04115 p53 signaling pathway
    106582883
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    106582883
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106582883
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    106582883
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106582883
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sasa02000]
    106582883
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106582883
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106582883
Transporters [BR:sasa02000]
 Other transporters
  Pores ion channels [TC:1]
   106582883
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 106582883
NCBI-ProteinID: XP_014021940
UniProt: A0A1S3P326
LinkDB
Position
ssa22
AA seq 219 aa
MSYSNRELVVFFISYKLSQRNYPCCQLVLEGASGRTEGDEAIANGSLGNNRNGRSNLGKP
SSPQGGIEAVKAALRDSVDEFELRYTRAFSDLSSQLHITPATAYHSFESVMDEVFRDGVN
WGRVVGLFAFGGALCVECVEKDMSHLVTRIADWMATYLDNHIQPWIQSQGGWDRFAEIFG
RDAAADVRRSQESLRKWLLVGVMLLSGVLVGTLIMKKCQ
NT seq 660 nt   +upstreamnt  +downstreamnt
atgtcttacagtaacagggaactggtggtgttttttataagctataaactgtcccagaga
aattatccatgttgtcagttggtgctggagggtgcaagtgggcggactgagggtgatgaa
gccattgcaaatgggtctttgggaaacaacaggaacggcagaagcaatttgggtaagcct
tcctctccacaggggggaattgaggcagtgaaagcagcactacgggactcagtggatgag
tttgagctgcgttacacccgcgccttcagtgacctctcctcccagctccacatcacccct
gccacagcctaccacagctttgagagcgtgatggacgaagtgttcagggatggggtcaac
tggggtcgcgtggtgggcctgtttgctttcggcggggccctgtgcgttgagtgtgttgag
aaggatatgagccacctggtgacgcgcatcgcagactggatggccacctacctggacaat
catatccagccctggatccagagccaaggaggatgggaccgttttgcggagatcttcggc
agagatgcagctgcagacgtccgacggtcccaggagagcttaagaaaatggctgctagtt
ggggtgatgctgctttcaggagtactggtcggcactctcatcatgaagaaatgccagtga

DBGET integrated database retrieval system