KEGG   Salmo salar (Atlantic salmon): 100196122
Entry
100196122         CDS       T04363                                 

Gene name
cdc2
Definition
(RefSeq) Cell division control protein 2 homolog
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04110  Cell cycle
sasa04114  Oocyte meiosis
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04540  Gap junction
sasa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100196122 (cdc2)
   04114 Oocyte meiosis
    100196122 (cdc2)
   04115 p53 signaling pathway
    100196122 (cdc2)
   04218 Cellular senescence
    100196122 (cdc2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100196122 (cdc2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100196122 (cdc2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    100196122 (cdc2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sasa03032]
    100196122 (cdc2)
   03036 Chromosome and associated proteins [BR:sasa03036]
    100196122 (cdc2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    100196122 (cdc2)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100196122 (cdc2)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     100196122 (cdc2)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100196122 (cdc2)
DNA replication proteins [BR:sasa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100196122 (cdc2)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100196122 (cdc2)
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100196122 (cdc2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase Kinase-like Seadorna_VP7
Other DBs
NCBI-GeneID: 100196122
NCBI-ProteinID: NP_001134623
UniProt: B5XBN1
LinkDB
Position
ssa18
AA seq 302 aa
MEDYVKIEKIGEGTYGVVYKGRHKSTGQVVAMKKIRLESEEEGVPSTAVREISLLKELAH
PNVVQLLDVLMQESRLYLIFEFLSMDLKKYLDSIPSGQYMDPMLVKSYLYQILEGILFCH
CRRVLHRDLKPQNLLIDNKGVIKLADFGLARAFGVPVRVYTHEVVTLWYRAPEVLLGAPR
YSTPVDVWSIGTIFAELATKKPLFHGDSEIDQLFRIFRTLGTPNNDIWPEVESLPDYKNT
FPKWKSGNLSSMVKNLDKNGIDLLAKTLIYDPPKRISARQAMSHPYFDDLDKTTLPASTV
KM
NT seq 909 nt   +upstreamnt  +downstreamnt
atggaagattacgtgaaaatagagaaaatcggagagggtacctatggggttgtgtacaaa
ggcagacacaagtcgacaggccaggtggtggcaatgaagaagatccgtctggagagtgag
gaggagggagtgccaagcacggctgttagagagatctctcttctcaaagagctagcgcac
cctaatgttgtacagcttctagatgtgctgatgcaggagtccagactgtacctcatcttt
gagttcctgtccatggacctgaagaaatacctagactctatcccctcgggccagtacatg
gaccccatgcttgtgaagagctatctgtaccagatcttggaaggcatcctgttctgccac
tgtagaagggtcctccacagagacctgaaaccccagaacctgctgattgacaacaaggga
gtgatcaagctggcagactttgggttggccagggctttcggggtgccagtccgggtatat
acccacgaggttgtgacactgtggtacagggctcctgaggtgctgctgggggccccacgg
tactccacccctgtggatgtctggagtatcgggaccatctttgcagagttggccacaaag
aaaccacttttccacggagactcagagatagaccagcttttcaggatcttcaggaccctt
ggtactcccaacaatgacatctggccagaggtggagtctctgcctgactacaagaacacg
ttccccaagtggaagtctgggaacctgtcttccatggtgaagaacctggacaagaacggc
attgatctgctcgctaaaacgctaatctatgacccacccaagaggatctctgccagacag
gctatgagccatccatactttgacgacctggacaaaaccactctacctgccagcacggtc
aagatgtaa

KEGG   Salmo salar (Atlantic salmon): 106607826
Entry
106607826         CDS       T04363                                 

Definition
(RefSeq) cyclin-dependent kinase 1-like
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04110  Cell cycle
sasa04114  Oocyte meiosis
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04540  Gap junction
sasa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106607826
   04114 Oocyte meiosis
    106607826
   04115 p53 signaling pathway
    106607826
   04218 Cellular senescence
    106607826
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106607826
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    106607826
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106607826
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sasa03032]
    106607826
   03036 Chromosome and associated proteins [BR:sasa03036]
    106607826
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106607826
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     106607826
    2.7.11.23  [RNA-polymerase]-subunit kinase
     106607826
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   106607826
DNA replication proteins [BR:sasa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    106607826
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106607826
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106607826
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Haspin_kinase Seadorna_VP7
Other DBs
NCBI-GeneID: 106607826
NCBI-ProteinID: XP_014060697
UniProt: A0A1S3S8M7
LinkDB
Position
ssa01
AA seq 308 aa
MAQPGTMEDYVKIEKIGEGTYGVVYKGRHKSTGQIVAMKKIRLESEEEGVPSTAVREISL
LKELAHPNVVRLLDVLMQESRLYLIFEFLSMDLKKYLDSIPSGQYMDPMLVKSYLYQILE
GILFCHCRRVLHRDLKPQNLLIDNKGVIKLADFGLARAFGVPVRVYTHEVVTLWYRAPEV
LLGAARYSTPVDVWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNDIWPEVESL
PDYKNTFPKWKSGNLSSMVKNLDKNGIDLLAKTLIYDPPKRISARQAMSHPYFDDLDKTT
LPASTVTM
NT seq 927 nt   +upstreamnt  +downstreamnt
atggcacaaccgggaacaatggaggattacgtgaaaatagagaaaatcggagagggtacc
tatggggttgtgtacaaaggcagacacaagtcgacaggccagatagtggccatgaagaag
atccgactggagagtgaggaggagggagtgccaagcacagctgttagagagatctctctg
ctcaaagagctagcgcaccctaatgttgtacgccttctagatgtgctgatgcaggagtcc
agactgtacctcatctttgagttcctttccatggacctgaagaaatacctagactctatc
ccctcgggccagtacatggaccccatgcttgtgaagagctatctgtaccagatcttggag
ggcatcctgttttgccactgtagaagggtcctccacagagacctgaagccccagaacctg
ctgattgacaacaagggagtgatcaagctggcagactttgggttggccagggccttcggg
gtgccagtccgggtatatacccacgaggttgtaacactgtggtacagggctcccgaggtt
ctgctgggtgccgcacggtactccacccctgtggatgtctggagtatcgggaccatcttt
gcagagttggccacaaagaaaccacttttccatggagactcagagattgaccagctcttc
aggatcttcagggcccttggtactcccaacaatgacatctggccagaggtagaatctctg
cctgactacaagaacacgttccccaagtggaagtcagggaatctgtcctccatggtgaaa
aacctggataagaatggcattgatctgctcgctaaaacgctgatctatgacccacccaag
aggatctctgctagacaggctatgagccatccatactttgacgacctggacaaaaccact
ctacctgccagcacggtcacgatgtaa

DBGET integrated database retrieval system