KEGG   Salmo salar (Atlantic salmon): 100196178
Entry
100196178         CDS       T04363                                 

Gene name
siva1, siva
Definition
(RefSeq) SIVA1 apoptosis inducing factor
  KO
K22744  apoptosis regulatory protein Siva
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100196178 (siva1)
SSDB
Motif
Pfam: Siva
Other DBs
NCBI-GeneID: 100196178
NCBI-ProteinID: NP_001134679
UniProt: B5XC99
LinkDB
Position
ssa01
AA seq 171 aa
MTKRAYPFAESFSSQYKIHVGQKELNHHGVFGNTYRQEVYEKTKDMLFNGTKAVMGKIWN
IDAEKCSAIQPSGSGMKPDVSQTLLRGQTLIGQDGKLQRTTPVQGSALAPVGCCVCQKVQ
GTRRPCSQCDRPACPSCIQQCASCSRSCCSVCTVIDYSGQYDQVLCCGCAS
NT seq 516 nt   +upstreamnt  +downstreamnt
atgactaaaagagcgtatcctttcgctgagtcattctcatcacagtataaaattcacgtt
ggacaaaaggagttgaatcatcacggcgtatttgggaacacgtacagacaagaggtctac
gaaaagacaaaggacatgctcttcaatggtaccaaagctgtcatggggaaaatctggaat
atagatgcagagaagtgctcagcaatacagccatcggggtcaggtatgaaacctgatgtg
agccagacactcctgaggggacagaccctgattgggcaggatggcaaactacagagaact
acacctgttcaaggttcagcgttggctccagtggggtgctgtgtgtgtcagaaggtccag
ggcaccaggaggccgtgctcccagtgtgaccgcccagcctgcccctcttgcatccagcag
tgtgccagctgctccagatcctgctgctctgtctgcaccgtcatcgactacagtggacag
tatgatcaagtgctgtgctgtggctgcgcatcataa

KEGG   Salmo salar (Atlantic salmon): 106610856
Entry
106610856         CDS       T04363                                 

Definition
(RefSeq) apoptosis regulatory protein Siva-like
  KO
K22744  apoptosis regulatory protein Siva
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106610856
SSDB
Motif
Pfam: Siva
Other DBs
NCBI-GeneID: 106610856
NCBI-ProteinID: XP_014065963
UniProt: A0A1S3SNP5
LinkDB
Position
ssa09
AA seq 137 aa
MGTSIDKKSTKRQTLLFNGTKAVMGKIWNIDTEKCSTIQPSGSGVTPDGSRTLLRGQTPI
GQDGRLTPVQGAVLVSKGCCVCQKAQRTRRQCSQCDRPACPSCIQQCSNCSSPCCSVCTV
IDYCGQYEQVLCCGCSS
NT seq 414 nt   +upstreamnt  +downstreamnt
atggggacaagtatagacaagaaatctacgaaaagacagaccctgctcttcaacggtacc
aaagctgtcatggggaaaatctggaatatagatacggagaagtgctcaacgatacagcct
tcggggtcaggtgtgacacctgacgggagccgcacactactgaggggacagacaccgatt
ggacaggatggcagacttacacctgtccaaggtgctgtgctggtttcaaaggggtgctgt
gtgtgtcagaaggcccagaggaccaggaggcagtgctcccagtgtgaccgcccagcctgc
ccctcctgcatccagcagtgctccaactgctccagcccctgttgctctgtctgcaccgtc
attgattactgtggccagtatgagcaagtactgtgctgcggctgctcatcctag

DBGET integrated database retrieval system