KEGG   Salmo salar (Atlantic salmon): 100196190
Entry
100196190         CDS       T04363                                 

Gene name
cssa28h16orf52, cp52b
Definition
(RefSeq) chromosome ssa28 open reading frame, human C16orf52
  KO
K23663  modulator of smoothened protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100196190 (cssa28h16orf52)
SSDB
Motif
Pfam: Atthog L_HMGIC_fpl Cyt_bd_oxida_I LtrA DUF2678 DUF2070 DUF2975
Other DBs
NCBI-GeneID: 100196190
NCBI-ProteinID: NP_001134691
UniProt: B5XCC6
LinkDB
Position
ssa28
AA seq 167 aa
MDKLTVISGCLFLAADIFAIASIANPDWINTGDAAGSLTVGLVRQCQTIHGRDRTCIPPR
LPPEWVTTLFFIILGIISLTVTCGLLVLSHWYREATRYARWIAFTGMILFCMAALIFPIG
FYIDEVGGQPYKLPNNTVVGSSYVLFVLSIFVTIVGLLFAGKVCLPG
NT seq 504 nt   +upstreamnt  +downstreamnt
atggataaactcaccgtcatatcaggatgtctcttcctagcagcagatatctttgctatc
gccagtattgccaatccggactggatcaacacaggagatgcagctggttccctgacggta
ggcctggtgcggcagtgccagaccatccacggacgtgaccggacctgtatccccccgcgg
ctgcccccagagtgggtcaccaccctcttcttcatcatcctgggcatcatctccctcacg
gtgacctgcggcctgctagtgttatcacactggtaccgtgaagccactcgttacgcccgc
tggattgccttcactgggatgatcctgttttgtatggcggctctgatatttcctatagga
ttttacatcgatgaggtcgggggtcaaccttataaactacccaacaacactgtggtgggg
tcctcatatgtactctttgttctatctatatttgtcactatagtgggactgctgtttgca
ggaaaggtctgcctgcctgggtga

KEGG   Salmo salar (Atlantic salmon): 106592731
Entry
106592731         CDS       T04363                                 

Definition
(RefSeq) uncharacterized protein C16orf52 homolog B
  KO
K23663  modulator of smoothened protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106592731
SSDB
Motif
Pfam: Atthog L_HMGIC_fpl Cyt_bd_oxida_I LtrA TctB DUF202 DUF998
Other DBs
NCBI-GeneID: 106592731
NCBI-ProteinID: XP_014039531
UniProt: A0A1S3S2E9
LinkDB
Position
Un
AA seq 167 aa
MDKLTIISGCLFLAADIFAIASIANPDWINTGESAGALTVGLVRQCQTIHGRDRTCIPPR
LPPEWVTTLFFIILGIISLTVTCGLLVASHWRREATKYARWIAFTGMILFCMAALIFPIG
FYINEVGGQPYKLPNNTVVGSSYVLFVLSIFFTIVGLLFAGKVCLPG
NT seq 504 nt   +upstreamnt  +downstreamnt
atggataaattaacaattatatcaggatgtttgtttctggcagcggatatctttgcaatc
gcaagcattgcaaaccccgactggatcaacacaggcgaatctgcaggtgccctgacggta
ggcctggtgcggcagtgccagaccatccacggtcgagaccgcacctgtatccccccgcgg
cttccccccgagtgggtcaccacgctcttcttcatcatcctgggtatcatctccctcacg
gtgacctgtggcctgctggtggcatcccactggcgccgcgaggccaccaaatacgcccgc
tggattgccttcaccgggatgatcctgttctgtatggcggcgctcatcttccccatcggt
ttctacatcaacgaggtgggtggccagccatacaagctgcccaacaacacggtggtgggc
tcctcctacgtcctctttgtcctctccatcttcttcaccatagtgggactgctgttcgca
ggcaaggtgtgcctgcccggctga

KEGG   Salmo salar (Atlantic salmon): 106601686
Entry
106601686         CDS       T04363                                 

Definition
(RefSeq) uncharacterized protein C16orf52 homolog B-like
  KO
K23663  modulator of smoothened protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106601686
SSDB
Motif
Pfam: Atthog Cyt_bd_oxida_I L_HMGIC_fpl DUF998 TctB
Other DBs
NCBI-GeneID: 106601686
NCBI-ProteinID: XP_014049509
UniProt: A0A1S3RCM1
LinkDB
Position
ssa03
AA seq 210 aa
MDSMAVIFATRGIVPISRVLLSPALPHRQDLWQKSTFAHLWLLRCLTGTIHGKKKHRCAL
EALARKLAVLSCSQSLTDGALTVGLVRQCQTIHGRDRTCIPPRLPPEWVTTLFFIILGII
SLTVTCGLLVASHWRREATKYARWIAFTGMILFCMAALIFPIGFYINEVGGQPYKLPNNT
VVGSSYVLFVLSIFFTIVGLLFAGKVCLPG
NT seq 633 nt   +upstreamnt  +downstreamnt
atggattcaatggcagttattttcgccacaaggggcattgtgccgatttctagagtgctt
ttgtcacccgcactgcctcacaggcaagatttgtggcaaaaaagtacatttgcacatctt
tggctcctgcgctgcctcacaggcactattcatggcaaaaaaaagcacaggtgcgcacta
gaagctcttgccaggaaattagcagttctcagctgttcgcagtctcttactgacggtgcc
ctgacggtaggcctggtgcggcagtgccagaccatccacggtcgggaccgcacctgtatc
cccccgcggcttccccccgagtgggtcaccacgctcttcttcatcatcctgggtatcatc
tccctcacggtgacctgtggcctgctggtggcatcccactggcgccgcgaggccaccaaa
tacgcccgctggattgccttcaccgggatgatcctgttctgtatggcggcgctcatcttc
cccatcggtttctacatcaacgaggtgggtggccagccatacaagctgcccaacaacacg
gtggtgggctcctcctacgtcctctttgtcctctccatcttcttcaccatagtgggactg
ctgttcgcaggcaaggtgtgcctgcccggctga

KEGG   Salmo salar (Atlantic salmon): 106606731
Entry
106606731         CDS       T04363                                 

Definition
(RefSeq) uncharacterized protein C16orf52 homolog B
  KO
K23663  modulator of smoothened protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106606731
SSDB
Motif
Pfam: Atthog L_HMGIC_fpl Cyt_bd_oxida_I LtrA TctB DUF202 DUF998
Other DBs
NCBI-GeneID: 106606731
NCBI-ProteinID: XP_014058565
UniProt: A0A1S3S2E9
LinkDB
Position
ssa06
AA seq 167 aa
MDKLTIISGCLFLAADIFAIASIANPDWINTGESAGALTVGLVRQCQTIHGRDRTCIPPR
LPPEWVTTLFFIILGIISLTVTCGLLVASHWRREATKYARWIAFTGMILFCMAALIFPIG
FYINEVGGQPYKLPNNTVVGSSYVLFVLSIFFTIVGLLFAGKVCLPG
NT seq 504 nt   +upstreamnt  +downstreamnt
atggataaattaacaattatatcaggatgtctgtttctggcagcggatatctttgcgatc
gcaagcattgcaaaccccgactggatcaacacaggcgaatctgcaggtgccctgacggta
ggcctggtgcggcagtgccagaccatccacggtcgagaccgcacctgtatccccccgcgg
cttccccccgagtgggtcaccacgctcttcttcatcatcctgggtatcatctccctcacg
gtgacctgtggcctgctggtggcatcccactggcgccgcgaggccaccaaatacgcccgc
tggattgccttcaccgggatgatcctgttctgtatggcggcgctcatcttccccatcggt
ttctacatcaacgaggtgggtggccagccatacaagctgcccaacaacacggtggtgggc
tcctcctacgtcctctttgtcctctccatcttcttcaccatagtgggactgctgttcgca
ggcaaggtgtgcctgcccggctga

KEGG   Salmo salar (Atlantic salmon): 106609997
Entry
106609997         CDS       T04363                                 

Gene name
CP52B
Definition
(RefSeq) uncharacterized protein C16orf52 homolog B-like
  KO
K23663  modulator of smoothened protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106609997 (CP52B)
SSDB
Motif
Pfam: Atthog L_HMGIC_fpl Cyt_bd_oxida_I TctB
Other DBs
NCBI-GeneID: 106609997
NCBI-ProteinID: XP_014064559
UniProt: A0A1S3SJQ3
LinkDB
Position
ssa01
AA seq 170 aa
MDKLTVISGCLFLAADIFAIASIANPDWINTGDATGKLGSLTVGLVRQCQTIHGREWTCI
PPRLPPEWVTTLFFIILGIISLTVTCGLLVASHWHREATRYARWIAFTGMILLCMAALIF
PIGFYIDEVGGQPYKLPNNTVVGSSYVLFVLSIFFTIVGLLFAGKVCLPG
NT seq 513 nt   +upstreamnt  +downstreamnt
atggataaactcaccgtcatatcaggatgcctctttctagcggcagatatctttgccatc
gccagtattgctaatccagactggatcaacacaggagatgcaactggtaagttaggttcc
ctgacggtaggcctggtgcggcagtgccagaccatccacggtcgtgaatggacctgtatc
cccccgcggctgccccctgagtgggtcaccaccctcttcttcattatcctgggcatcatc
tccctcacggtgacctgcggcctgttggtggcatcacactggcaccgcgaggccacccgt
tacgcccgctggatcgccttcactgggatgatcctgctctgtatggcagctctgatattt
cctataggattttacatcgatgaggtcgggggtcaaccttataaactacccaacaacact
gtggtggggtcctcatatgtactctttgtcctatctatatttttcactatagtgggacta
ctgtttgcagggaaggtctgcttgcctgggtga

DBGET integrated database retrieval system