KEGG   Salmo salar (Atlantic salmon): 100196430Help
Entry
100196430         CDS       T04363                                 

Gene name
mgst2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00480  Glutathione metabolism
sasa00980  Metabolism of xenobiotics by cytochrome P450
sasa00982  Drug metabolism - cytochrome P450
sasa00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:sasa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100196430 (mgst2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100196430 (mgst2)
   00982 Drug metabolism - cytochrome P450
    100196430 (mgst2)
   00983 Drug metabolism - other enzymes
    100196430 (mgst2)
Enzymes [BR:sasa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100196430 (mgst2)
Transporters [BR:sasa02000]
 Other Transporters
  Pores ion channels [TC:1]
   100196430 (mgst2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 100196430
NCBI-ProteinID: NP_001134931
UniProt: B5XFC2
LinkDB All DBs
Position
ssa05
AA seq 146 aa AA seqDB search
MTTEIPVLLAAVSLFSALQIGYLARRVGLARMTHKIIPPTVTGPPEFERTFRAHQNNVEL
YPVFLVVLWTSGLLCSEVLAVLGGVVYMVARHMYFNGYVMSTEKRLPGFYLTLGALFCLS
VLSTIGILHGIFLEYFYKIVSMMVTH
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgactacagaaatacccgttctgctagctgccgtgtctctgttttctgcccttcaaatt
gggtacctggcgagacgggtggggctggcgagaatgacacacaagatcataccacccact
gtcactggaccaccggagtttgagagaacattccgggcacatcagaacaatgttgagttg
tacccagtcttcctagtggtgctgtggacttctggactgctctgcagtgaagtgcttgct
gttctcggaggtgttgtgtatatggtggctcgacacatgtatttcaatggatacgtcatg
tccactgaaaaaaggttgcctgggttttacctgactttgggtgccttattctgcttgtct
gtgctcagcaccatcggtattcttcatggtattttccttgaatacttttacaaaatagtt
tctatgatggtaacacattag

DBGET integrated database retrieval system