Salmo salar (Atlantic salmon): 100196442 Help Entry 100196442         CDS       T04363                                  Gene name ga45g Definition (RefSeq) Growth arrest and DNA-damage-inducible protein GADD45 gamma   KO K04402   growth arrest and DNA-damage-inducible protein Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04068   FoxO signaling pathway sasa04110   Cell cycle sasa04115   p53 signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100196442 (ga45g)    04068 FoxO signaling pathway     100196442 (ga45g)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100196442 (ga45g)    04210 Apoptosis     100196442 (ga45g)    04115 p53 signaling pathway     100196442 (ga45g)    04218 Cellular senescence     100196442 (ga45g)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sasa03036]     100196442 (ga45g) Chromosome and associated proteins [BR:sasa03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Centrosome duplication proteins     Other centrosome duplication proteins      100196442 (ga45g)   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      100196442 (ga45g) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L7Ae Motif Other DBs NCBI-GeneID:  100196442 NCBI-ProteinID:  NP_001134943 UniProt:  B5XFH7 LinkDB All DBs Position ssa20 AA seq 161 aa AA seqDB search MTLELEEIFGQESALDTTDRVQSAGTALEELLVSAKKQDYLTVGVYESAKIMNVDPDNVA FCVLATDEEYECDIALQIHFTLIQAFCFDNDINVVRVNDIERLADLVGTEEAGEPKDAHC ILVTSPGAESWKDPALDKLHLFCEESRSVYDWLPTITLPER NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgacactggaactggaagagatctttggacaggagagcgcactcgacaccactgataga gtgcaaagtgcaggcacagccctggaggagttgttggtgtctgcaaagaaacaggactac cttaccgtgggagtctacgagtctgccaaaattatgaatgttgatccagacaatgtggca ttctgcgttctggcgacagacgaggagtacgaatgcgacatcgctctccagatccacttc accctcatccaggctttctgcttcgataacgacataaatgtggtacgcgttaacgatatc gagcgcctggctgacctcgtgggcacagaagaggctggcgaacccaaggacgcacattgc attcttgtcacgagccctggtgctgagtcatggaaagaccctgctctggacaaactgcat ctgttttgtgaggagagccgcagtgtgtatgactggcttcccactatcactctccctgaa cgctga

Salmo salar (Atlantic salmon): 106560326 Help Entry 106560326         CDS       T04363                                  Gene name GA45A Definition (RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha-like   KO K04402   growth arrest and DNA-damage-inducible protein Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04068   FoxO signaling pathway sasa04110   Cell cycle sasa04115   p53 signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106560326 (GA45A)    04068 FoxO signaling pathway     106560326 (GA45A)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     106560326 (GA45A)    04210 Apoptosis     106560326 (GA45A)    04115 p53 signaling pathway     106560326 (GA45A)    04218 Cellular senescence     106560326 (GA45A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sasa03036]     106560326 (GA45A) Chromosome and associated proteins [BR:sasa03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Centrosome duplication proteins     Other centrosome duplication proteins      106560326 (GA45A)   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      106560326 (GA45A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L7Ae Motif Other DBs NCBI-GeneID:  106560326 NCBI-ProteinID:  XP_013978610 UniProt:  A0A1S3KJ35 LinkDB All DBs Position ssa10 AA seq 189 aa AA seqDB search MRKRAGHKVAKLTPTWRDHLWISCLQRGYFLMCNMTFEETSGENSTERMDSVAKALEEVL CSALPQGCITVGVYEAAKSLNVDPDNVVLCLLATDEEQVEDVALQIHFTLIQAFCCENDI NILRVSNMRRLAEILGGVKPGGEPMDMHCVLVTNPQLTTWKDPALSKVNLFCRDSRILDQ WVPIINLPD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaggaaaagagcaggacacaaggtcgcgaaattaactccgacgtggagagatcatctg tggatatcctgtcttcaacgtggatattttctaatgtgcaatatgacttttgaggaaacc agcggagaaaactctacagaaaggatggattcggtggctaaagcactggaggaggtcctc tgctccgcgttacctcagggttgcatcactgtcggggtatacgaggcagccaagtcgctc aatgttgacccggataatgtggtgttgtgcctcctggctacggacgaggaacaggtagaa gacgtggccctccagatccacttcacccttatccaggcgttctgctgcgagaacgacatc aacatcctgcgggtcagcaacatgaggcgcctcgctgagatccttggaggagtgaagcca ggaggagagccaatggacatgcactgtgtactagttactaacccccagttgaccacgtgg aaggacccagcactgagcaaagtgaatcttttctgtagagacagtcgaatcctggaccag tgggtccccatcatcaacctacctgactga

Salmo salar (Atlantic salmon): 106563369 Help Entry 106563369         CDS       T04363                                  Definition (RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like   KO K04402   growth arrest and DNA-damage-inducible protein Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04068   FoxO signaling pathway sasa04110   Cell cycle sasa04115   p53 signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106563369    04068 FoxO signaling pathway     106563369  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     106563369    04210 Apoptosis     106563369    04115 p53 signaling pathway     106563369    04218 Cellular senescence     106563369  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sasa03036]     106563369 Chromosome and associated proteins [BR:sasa03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Centrosome duplication proteins     Other centrosome duplication proteins      106563369   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      106563369 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L7Ae Motif Other DBs NCBI-GeneID:  106563369 NCBI-ProteinID:  XP_013984345 UniProt:  A0A1S3L0J6 LinkDB All DBs Position ssa11 AA seq 140 aa AA seqDB search MEAIGKSLKEALKSAQCEDHLTVGVYESAKIMNDDPDSVSFCVLATDAEWECDIALQIHF TLIQSYCFDNDISIVRVNDLQLLAEIVGDKAGQHEDAHCCLITNSADGSWEDPALEKLHL FCEESRGLNDWVPEITIPKR NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggaagctattggcaaatctctgaaggaagctctcaagtctgcccagtgtgaggatcac ctcactgttggtgtctatgagagtgccaaaataatgaatgatgacccagacagtgtgtct ttctgtgttctggcaaccgatgcggagtgggagtgtgacattgctctccagatccacttc accctcatccagtcttactgttttgacaacgacatcagcattgttagagtgaacgacttg cagctcctggccgagattgttggtgacaaggctggccagcatgaagatgcccactgctgt cttatcacgaactcagctgatggttcttgggaggaccccgctctggagaagctgcacctg ttctgtgaggagagccgcggtctgaacgactgggttccagagatcaccatccctaagcgc tga

Salmo salar (Atlantic salmon): 106563370 Help Entry 106563370         CDS       T04363                                  Definition (RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like   KO K04402   growth arrest and DNA-damage-inducible protein Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04068   FoxO signaling pathway sasa04110   Cell cycle sasa04115   p53 signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106563370    04068 FoxO signaling pathway     106563370  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     106563370    04210 Apoptosis     106563370    04115 p53 signaling pathway     106563370    04218 Cellular senescence     106563370  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sasa03036]     106563370 Chromosome and associated proteins [BR:sasa03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Centrosome duplication proteins     Other centrosome duplication proteins      106563370   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      106563370 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L7Ae Motif Other DBs NCBI-GeneID:  106563370 NCBI-ProteinID:  XP_013984346 UniProt:  A0A1S3L049 LinkDB All DBs Position ssa11 AA seq 154 aa AA seqDB search MTLEEVLIQKPAERAQCTGKALEEVLLSAKDNNCLTVGVYESAKVMNVDPDNVSFCVLAT DEEWECDIALQIHFTLIQSYCFDNDISIVRVNNMQRLAEIVRDKTGQLEDAHCCLIMNSA DGSWEDPALEKLHLFCEESRGLNDWVPEITIPKR NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgactcttgaggaagttctgatccagaagcccgctgagcgtgcccagtgcaccgggaaa gcgctggaggaagttctgctctccgctaaagacaacaactgcctgactgtcggtgtctat gagtctgctaaagttatgaatgttgacccagacaatgtgtctttctgtgtcctggccacc gatgaggagtgggagtgtgacattgctctccagatccacttcaccctcattcagtcttac tgttttgacaacgacatcagcatcgtcagggtgaacaacatgcagcgactggccgaaatt gttcgtgacaagactggccagcttgaagatgcccactgctgtcttatcatgaactcagct gatggttcttgggaggaccccgctctggagaagctgcacctgttctgtgaggagagccgc ggtctgaacgactgggttccagagatcaccatccctaagcgctga

Salmo salar (Atlantic salmon): 106566617 Help Entry 106566617         CDS       T04363                                  Definition (RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like   KO K04402   growth arrest and DNA-damage-inducible protein Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04068   FoxO signaling pathway sasa04110   Cell cycle sasa04115   p53 signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106566617    04068 FoxO signaling pathway     106566617  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     106566617    04210 Apoptosis     106566617    04115 p53 signaling pathway     106566617    04218 Cellular senescence     106566617  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sasa03036]     106566617 Chromosome and associated proteins [BR:sasa03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Centrosome duplication proteins     Other centrosome duplication proteins      106566617   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      106566617 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L7Ae Motif Other DBs NCBI-GeneID:  106566617 NCBI-ProteinID:  XP_013990280 UniProt:  A0A1S3LHG8 LinkDB All DBs Position ssa01 AA seq 154 aa AA seqDB search MTLEEVLIQKFAERAQCTGKALEEVLLSAKENDCLTVGVYESAKVMNVVPDSVSFCVLAT DEEWECDIALQIHFTLIQSFCFDNDISIVRVNDMQRLAEIVGDKTVQLEDAHCCLITNPV DGSWEDAALEKLHLFCEESRSLNDWVPEITLLER NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atgactcttgaggaagttctgatccagaagttcgctgagcgtgcccagtgcaccggcaaa gcactagaggaagttttgctctctgctaaagaaaatgactgcctgacagttggtgtctac gagtctgctaaagttatgaatgttgttccagacagcgtgtctttctgcgttctggccacc gatgaggagtgggagtgtgacattgctctccagatccacttcaccctcatccagtctttc tgttttgacaacgacatcagcatcgtcagagtgaacgacatgcagcgcctggccgagatt gttggggacaagactgtccagcttgaagatgcccactgctgtcttatcacgaacccagtt gatggttcttgggaggatgctgctctggagaagctgcacctgttctgtgaggagagccgc agtctgaacgactgggttccagagatcacccttcttgagcgctga

Salmo salar (Atlantic salmon): 106567216 Help Entry 106567216         CDS       T04363                                  Definition (RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like   KO K04402   growth arrest and DNA-damage-inducible protein Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04068   FoxO signaling pathway sasa04110   Cell cycle sasa04115   p53 signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106567216    04068 FoxO signaling pathway     106567216  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     106567216    04210 Apoptosis     106567216    04115 p53 signaling pathway     106567216    04218 Cellular senescence     106567216  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sasa03036]     106567216 Chromosome and associated proteins [BR:sasa03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Centrosome duplication proteins     Other centrosome duplication proteins      106567216   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      106567216 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L7Ae CpXC Motif Other DBs NCBI-GeneID:  106567216 NCBI-ProteinID:  XP_013991719 UniProt:  A0A1S3LMG8 LinkDB All DBs Position ssa01 AA seq 140 aa AA seqDB search MEAIGKSLKEALKSAQCEDCLTVGVYESAKIMNDDPDSVSFCVLATDEEWECDIALQIHF TLIQSFCFDNDISIVRVNDMQRLAEIVGDKTVQLEDAHCCLITNPVDGSCEDAALEKLHL FCEESRSLNDWVPEITLLER NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggaagctattggcaaatctctgaaggaagctctcaagtctgcccagtgtgaggattgc ctcactgttggtgtctatgagagtgccaaaataatgaatgatgatccagacagcgtgtct ttttgtgtcctggccaccgatgaggagtgggagtgtgacattgctctccagatccacttc accctcatccagtctttctgttttgacaacgacatcagcatcgtcagagtgaacgacatg cagcgcctggctgagattgttggggacaagactgtccagcttgaagatgcccactgctgt cttatcacgaacccagttgatggttcttgcgaggatgctgctctggagaagctgcacctg ttctgtgaggagagccgcagtctgaacgactgggttccagagatcacccttcttgagcgc tga

Salmo salar (Atlantic salmon): 106568974 Help Entry 106568974         CDS       T04363                                  Gene name GA45A Definition (RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha-like   KO K04402   growth arrest and DNA-damage-inducible protein Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04068   FoxO signaling pathway sasa04110   Cell cycle sasa04115   p53 signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106568974 (GA45A)    04068 FoxO signaling pathway     106568974 (GA45A)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     106568974 (GA45A)    04210 Apoptosis     106568974 (GA45A)    04115 p53 signaling pathway     106568974 (GA45A)    04218 Cellular senescence     106568974 (GA45A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sasa03036]     106568974 (GA45A) Chromosome and associated proteins [BR:sasa03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Centrosome duplication proteins     Other centrosome duplication proteins      106568974 (GA45A)   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      106568974 (GA45A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L7Ae Motif Other DBs NCBI-GeneID:  106568974 NCBI-ProteinID:  XP_013995364 UniProt:  B9EQ49 LinkDB All DBs Position ssa14 AA seq 159 aa AA seqDB search MCKMTFEELSGDYSAERMDTVAKALEEVLSLALPQGCITVGVYEAAKSLNVDPDNVVLCI LATDDEDVKDVALQIHFTLIQAFCCENDISILRVNNTRRLAEILGGGTQGGEPMDLHCVL VTSPHSSSWKDPALSKVNRFCRESRCMDQWVPIINLPER NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgtgcaaaatgacatttgaggaactaagtggggattattctgcagaaaggatggataca gtggcaaaagcattggaagaggttctctcattggcattaccccaaggatgcataacagta ggggtctatgaagcagcaaaatcattgaatgtagatccagataatgtggttctgtgcatc ctggctacagatgacgaggatgtaaaggacgtggcccttcagatccacttcaccctgatc caggcattctgctgtgagaatgacatcagcatcctgcgagttaacaacaccaggcgtctg gcagagatcctcggcggagggacacaggggggagagcccatggatctgcactgtgtcctg gtcactagcccacactcctcctcctggaaagacccagccctgagcaaagtgaaccgcttc tgcagggagagccggtgcatggaccagtgggtacccatcattaacctccctgagcgatga

Salmo salar (Atlantic salmon): 106573930 Help Entry 106573930         CDS       T04363                                  Gene name GA45B Definition (RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta-like   KO K04402   growth arrest and DNA-damage-inducible protein Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04068   FoxO signaling pathway sasa04110   Cell cycle sasa04115   p53 signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106573930 (GA45B)    04068 FoxO signaling pathway     106573930 (GA45B)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     106573930 (GA45B)    04210 Apoptosis     106573930 (GA45B)    04115 p53 signaling pathway     106573930 (GA45B)    04218 Cellular senescence     106573930 (GA45B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sasa03036]     106573930 (GA45B) Chromosome and associated proteins [BR:sasa03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Centrosome duplication proteins     Other centrosome duplication proteins      106573930 (GA45B)   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      106573930 (GA45B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L7Ae Motif Other DBs NCBI-GeneID:  106573930 NCBI-ProteinID:  XP_014004869 UniProt:  B5X8I1 LinkDB All DBs Position ssa16 AA seq 160 aa AA seqDB search MTLEELGCNITEKKMETVSQALEELLVAAQQQDCLTLGVYESAKLMNVDPDSVVLCVLAT DEEDEDDIALQIHFTLIQAFCCDNDINILRVSGIRRLAQVLGEPSTADSNGNEPKDLHCI LVTNTQCQSLKCQALQDVGNYCEESRCKNQWVPYLALQER NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgactctggaagaactgggatgcaatatcactgagaaaaagatggagaccgtgagtcaa gctctagaagagctgctggtggcagcgcagcaacaagactgcctgactttgggagtctac gagtctgcaaaactgatgaatgttgatcctgatagtgtagtcttgtgtgttctggcgact gatgaggaagacgaggatgacatcgcactgcagattcacttcacgctcatccaagccttc tgctgcgacaacgacatcaacatactgagagtctcgggcatcaggcgcctcgctcaggtt cttggcgagccaagcaccgctgacagcaacggcaacgagcccaaagatctgcactgcatc cttgtcactaacacccagtgccaatctctgaaatgccaagcgttgcaggacgtgggcaac tactgcgaggagagccgctgcaagaaccagtgggtgccttatctggccctgcaggagcgc tga

Salmo salar (Atlantic salmon): 106584172 Help Entry 106584172         CDS       T04363                                  Definition (RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha-like   KO K04402   growth arrest and DNA-damage-inducible protein Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04068   FoxO signaling pathway sasa04110   Cell cycle sasa04115   p53 signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106584172    04068 FoxO signaling pathway     106584172  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     106584172    04210 Apoptosis     106584172    04115 p53 signaling pathway     106584172    04218 Cellular senescence     106584172  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sasa03036]     106584172 Chromosome and associated proteins [BR:sasa03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Centrosome duplication proteins     Other centrosome duplication proteins      106584172   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      106584172 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L7Ae Motif Other DBs NCBI-GeneID:  106584172 NCBI-ProteinID:  XP_014024594 UniProt:  A0A1S3PAJ9 LinkDB All DBs Position ssa23 AA seq 157 aa AA seqDB search MCNMTFEETSGENSTERMDSVSKALEEVISSALPQGCVTIGVYEAAKSLNVDPDNVVLCL LATDEEQVEDVALQIHFTLIQAFCCENDINILRVSNMRRLAEILGGVKPGDEPMDLHCVL VTKSTTCKDPALSKVNRFCRDSRILDQWVPIINLPDR NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atgtgcaatatgacttttgaggaaaccagtggagaaaactctacagaaaggatggattct gtgtctaaagcattggaggaggtcatcagctctgcgttaccccaaggttgcgtcactata ggagtctacgaggcagcaaagtccctcaatgtggacccggataatgtggtactgtgcctc ttggccacagatgaggagcaggtcgaggacgtggctttacagatccacttcaccctgatt caggcgttctgctgcgagaacgacatcaacatcctgcgggtcagcaacatgaggcgcctc gctgagatccttggaggagtgaagcctggagacgagcccatggacctgcactgtgtgcta gttactaagtcaaccacgtgcaaggacccagctctgagcaaagtgaatcgcttctgtaga gacagtcgaatactggaccagtgggtccccatcatcaacttacctgaccggtga

Salmo salar (Atlantic salmon): 106585195 Help Entry 106585195         CDS       T04363                                  Gene name GA45G Definition (RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like   KO K04402   growth arrest and DNA-damage-inducible protein Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04068   FoxO signaling pathway sasa04110   Cell cycle sasa04115   p53 signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106585195 (GA45G)    04068 FoxO signaling pathway     106585195 (GA45G)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     106585195 (GA45G)    04210 Apoptosis     106585195 (GA45G)    04115 p53 signaling pathway     106585195 (GA45G)    04218 Cellular senescence     106585195 (GA45G)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sasa03036]     106585195 (GA45G) Chromosome and associated proteins [BR:sasa03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Centrosome duplication proteins     Other centrosome duplication proteins      106585195 (GA45G)   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      106585195 (GA45G) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L7Ae Motif Other DBs NCBI-GeneID:  106585195 NCBI-ProteinID:  XP_014026604 UniProt:  B9EMU6 LinkDB All DBs Position ssa24 AA seq 161 aa AA seqDB search MTLELEEIRGQENALDTTDRVQIAGTALEELLVSAKKQDYLTVGVYESAKVMNVDADNVA FCVLATDEEYECDIALQIHFTLIQAFCFDNYINVVRVNDIERLADLVGTDETGEPKDAHC ILVTSPGAGSWKDPALDKLHLFCEESRSVYDWVPTITLPER NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atgactctggaactggaagagatccgtggacaggagaacgcactcgataccaccgataga gtgcaaattgcaggcacagccctggaggagctgttggtgtctgcaaagaaacaggactat cttaccgtgggagtctacgagtctgccaaagttatgaatgttgacgcagacaatgtggca ttctgcgttctggcgacagacgaggagtacgaatgcgacatcgcgctccagatccacttc accctcatccaggcgttctgcttcgataactacatcaacgtggtgcgcgttaacgacatc gagcgcctggctgacctcgtgggcacggacgaaactggggaacccaaggacgcacattgc attcttgtcacgagccctggtgctggatcgtggaaagaccctgctttggacaaactgcat ctgttctgtgaggagagccgcagtgtgtatgactgggttcccaccatcaccctacctgaa cgctga

Salmo salar (Atlantic salmon): 106598934 Help Entry 106598934         CDS       T04363                                  Gene name GA45A Definition (RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha-like   KO K04402   growth arrest and DNA-damage-inducible protein Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04068   FoxO signaling pathway sasa04110   Cell cycle sasa04115   p53 signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106598934 (GA45A)    04068 FoxO signaling pathway     106598934 (GA45A)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     106598934 (GA45A)    04210 Apoptosis     106598934 (GA45A)    04115 p53 signaling pathway     106598934 (GA45A)    04218 Cellular senescence     106598934 (GA45A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sasa03036]     106598934 (GA45A) Chromosome and associated proteins [BR:sasa03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Centrosome duplication proteins     Other centrosome duplication proteins      106598934 (GA45A)   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      106598934 (GA45A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L7Ae Motif Other DBs NCBI-GeneID:  106598934 NCBI-ProteinID:  XP_014045437 UniProt:  B9ELG3 LinkDB All DBs Position ssa03 AA seq 160 aa AA seqDB search MCKMTFEELSGEYSTERMDTVTKALEEVLSSALPQGCITVGVYEAAKSLNVDPDNVVLCI LATDDEDVKDVALQIHFTLIQAFCCENDINILRVNNTRRLAEILGGGGKQGGEPMDLHCV LVTSPHSSSWKDPALSKVNRFCRESRCMDQWVPIINLPER NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtgcaagatgacatttgaggaactaagtggggaatattctacagaaaggatggataca gtgacaaaagccttggaagaggttctctcatcagcattaccccaaggatgcataacagta ggggtctatgaagcagctaaatcattgaatgtagatccagataatgtggttctgtgcatc ctggctacggatgacgaggatgtaaaggacgtggcccttcagatccacttcaccctgatc caggcattctgctgtgagaatgacatcaacatcctgcgagtgaacaacacccggcgtctg gcagagatccttggagggggagggaaacaagggggagagcccatggacctgcactgtgtc ctggtcacaagcccacactcctcgtcctggaaagacccagccctgagcaaagtgaaccgc ttctgcagggagagccgttgcatggaccagtgggtgcccatcattaacctcccagagcgc tga

Salmo salar (Atlantic salmon): 106613608 Help Entry 106613608         CDS       T04363                                  Gene name GA45B Definition (RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta-like   KO K04402   growth arrest and DNA-damage-inducible protein Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04068   FoxO signaling pathway sasa04110   Cell cycle sasa04115   p53 signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106613608 (GA45B)    04068 FoxO signaling pathway     106613608 (GA45B)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     106613608 (GA45B)    04210 Apoptosis     106613608 (GA45B)    04115 p53 signaling pathway     106613608 (GA45B)    04218 Cellular senescence     106613608 (GA45B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sasa03036]     106613608 (GA45B) Chromosome and associated proteins [BR:sasa03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Centrosome duplication proteins     Other centrosome duplication proteins      106613608 (GA45B)   Sister chromatid separation proteins    Aurora kinases     Regulators of Aurora kinases      106613608 (GA45B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_L7Ae Motif Other DBs NCBI-GeneID:  106613608 NCBI-ProteinID:  XP_014071517 UniProt:  B5XER1 LinkDB All DBs Position ssa10 AA seq 158 aa AA seqDB search MTLEELVGCNITEKKMETVNQALEELLVAAQQQDCLTVGVYESAKLMNVDPDSVVLCVLA TDEDVIPLQIHFTLIQAFCCDNDINILRVSGMRRLAQVLGEPSTADSNGNEPNDLHCILV TNTQCQSLKCQALQDVSNYCEESRCKNQWVPYLSLQER NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atgactctggaagaactcgttggatgcaatatcactgagaaaaagatggagaccgtgaat caagcactagaagagctgctggtggcagcgcagcaacaagactgcctgactgtgggagtc tacgagtctgcaaaactgatgaatgttgatcctgacagtgttgtgttgtgtgttctggcg actgacgaggatgtcattccactgcagattcacttcacgctcatccaagccttctgttgc gacaacgacatcaacatactgcgtgtctccggcatgaggcgcctcgctcaggttcttggc gagccaagcaccgctgacagcaacggcaacgagcccaatgatctgcactgcatccttgtc actaacacccagtgccagtctctgaaatgccaagcgttgcaggatgtcagcaactactgc gaggagagccgctgcaagaaccaatgggtaccttacctgtccctgcaggagcgctga

DBGET integrated database retrieval system