KEGG   Salmo salar (Atlantic salmon): 100196442
Entry
100196442         CDS       T04363                                 

Gene name
ga45g
Definition
(RefSeq) Growth arrest and DNA-damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100196442 (ga45g)
   04068 FoxO signaling pathway
    100196442 (ga45g)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100196442 (ga45g)
   04210 Apoptosis
    100196442 (ga45g)
   04115 p53 signaling pathway
    100196442 (ga45g)
   04218 Cellular senescence
    100196442 (ga45g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    100196442 (ga45g)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     100196442 (ga45g)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100196442 (ga45g)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 100196442
NCBI-ProteinID: NP_001134943
UniProt: B5XFH7
LinkDB
Position
ssa20
AA seq 161 aa
MTLELEEIFGQESALDTTDRVQSAGTALEELLVSAKKQDYLTVGVYESAKIMNVDPDNVA
FCVLATDEEYECDIALQIHFTLIQAFCFDNDINVVRVNDIERLADLVGTEEAGEPKDAHC
ILVTSPGAESWKDPALDKLHLFCEESRSVYDWLPTITLPER
NT seq 486 nt   +upstreamnt  +downstreamnt
atgacactggaactggaagagatctttggacaggagagcgcactcgacaccactgataga
gtgcaaagtgcaggcacagccctggaggagttgttggtgtctgcaaagaaacaggactac
cttaccgtgggagtctacgagtctgccaaaattatgaatgttgatccagacaatgtggca
ttctgcgttctggcgacagacgaggagtacgaatgcgacatcgctctccagatccacttc
accctcatccaggctttctgcttcgataacgacataaatgtggtacgcgttaacgatatc
gagcgcctggctgacctcgtgggcacagaagaggctggcgaacccaaggacgcacattgc
attcttgtcacgagccctggtgctgagtcatggaaagaccctgctctggacaaactgcat
ctgttttgtgaggagagccgcagtgtgtatgactggcttcccactatcactctccctgaa
cgctga

KEGG   Salmo salar (Atlantic salmon): 106560326
Entry
106560326         CDS       T04363                                 

Gene name
GA45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106560326 (GA45A)
   04068 FoxO signaling pathway
    106560326 (GA45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106560326 (GA45A)
   04210 Apoptosis
    106560326 (GA45A)
   04115 p53 signaling pathway
    106560326 (GA45A)
   04218 Cellular senescence
    106560326 (GA45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106560326 (GA45A)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     106560326 (GA45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     106560326 (GA45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 106560326
NCBI-ProteinID: XP_013978610
UniProt: A0A1S3KJ35
LinkDB
Position
ssa10
AA seq 189 aa
MRKRAGHKVAKLTPTWRDHLWISCLQRGYFLMCNMTFEETSGENSTERMDSVAKALEEVL
CSALPQGCITVGVYEAAKSLNVDPDNVVLCLLATDEEQVEDVALQIHFTLIQAFCCENDI
NILRVSNMRRLAEILGGVKPGGEPMDMHCVLVTNPQLTTWKDPALSKVNLFCRDSRILDQ
WVPIINLPD
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaggaaaagagcaggacacaaggtcgcgaaattaactccgacgtggagagatcatctg
tggatatcctgtcttcaacgtggatattttctaatgtgcaatatgacttttgaggaaacc
agcggagaaaactctacagaaaggatggattcggtggctaaagcactggaggaggtcctc
tgctccgcgttacctcagggttgcatcactgtcggggtatacgaggcagccaagtcgctc
aatgttgacccggataatgtggtgttgtgcctcctggctacggacgaggaacaggtagaa
gacgtggccctccagatccacttcacccttatccaggcgttctgctgcgagaacgacatc
aacatcctgcgggtcagcaacatgaggcgcctcgctgagatccttggaggagtgaagcca
ggaggagagccaatggacatgcactgtgtactagttactaacccccagttgaccacgtgg
aaggacccagcactgagcaaagtgaatcttttctgtagagacagtcgaatcctggaccag
tgggtccccatcatcaacctacctgactga

KEGG   Salmo salar (Atlantic salmon): 106563369
Entry
106563369         CDS       T04363                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106563369
   04068 FoxO signaling pathway
    106563369
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106563369
   04210 Apoptosis
    106563369
   04115 p53 signaling pathway
    106563369
   04218 Cellular senescence
    106563369
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106563369
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     106563369
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     106563369
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 106563369
NCBI-ProteinID: XP_013984345
UniProt: A0A1S3L0J6
LinkDB
Position
ssa11
AA seq 140 aa
MEAIGKSLKEALKSAQCEDHLTVGVYESAKIMNDDPDSVSFCVLATDAEWECDIALQIHF
TLIQSYCFDNDISIVRVNDLQLLAEIVGDKAGQHEDAHCCLITNSADGSWEDPALEKLHL
FCEESRGLNDWVPEITIPKR
NT seq 423 nt   +upstreamnt  +downstreamnt
atggaagctattggcaaatctctgaaggaagctctcaagtctgcccagtgtgaggatcac
ctcactgttggtgtctatgagagtgccaaaataatgaatgatgacccagacagtgtgtct
ttctgtgttctggcaaccgatgcggagtgggagtgtgacattgctctccagatccacttc
accctcatccagtcttactgttttgacaacgacatcagcattgttagagtgaacgacttg
cagctcctggccgagattgttggtgacaaggctggccagcatgaagatgcccactgctgt
cttatcacgaactcagctgatggttcttgggaggaccccgctctggagaagctgcacctg
ttctgtgaggagagccgcggtctgaacgactgggttccagagatcaccatccctaagcgc
tga

KEGG   Salmo salar (Atlantic salmon): 106563370
Entry
106563370         CDS       T04363                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106563370
   04068 FoxO signaling pathway
    106563370
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106563370
   04210 Apoptosis
    106563370
   04115 p53 signaling pathway
    106563370
   04218 Cellular senescence
    106563370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106563370
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     106563370
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     106563370
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 106563370
NCBI-ProteinID: XP_013984346
UniProt: A0A1S3L049
LinkDB
Position
ssa11
AA seq 154 aa
MTLEEVLIQKPAERAQCTGKALEEVLLSAKDNNCLTVGVYESAKVMNVDPDNVSFCVLAT
DEEWECDIALQIHFTLIQSYCFDNDISIVRVNNMQRLAEIVRDKTGQLEDAHCCLIMNSA
DGSWEDPALEKLHLFCEESRGLNDWVPEITIPKR
NT seq 465 nt   +upstreamnt  +downstreamnt
atgactcttgaggaagttctgatccagaagcccgctgagcgtgcccagtgcaccgggaaa
gcgctggaggaagttctgctctccgctaaagacaacaactgcctgactgtcggtgtctat
gagtctgctaaagttatgaatgttgacccagacaatgtgtctttctgtgtcctggccacc
gatgaggagtgggagtgtgacattgctctccagatccacttcaccctcattcagtcttac
tgttttgacaacgacatcagcatcgtcagggtgaacaacatgcagcgactggccgaaatt
gttcgtgacaagactggccagcttgaagatgcccactgctgtcttatcatgaactcagct
gatggttcttgggaggaccccgctctggagaagctgcacctgttctgtgaggagagccgc
ggtctgaacgactgggttccagagatcaccatccctaagcgctga

KEGG   Salmo salar (Atlantic salmon): 106566617
Entry
106566617         CDS       T04363                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106566617
   04068 FoxO signaling pathway
    106566617
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106566617
   04210 Apoptosis
    106566617
   04115 p53 signaling pathway
    106566617
   04218 Cellular senescence
    106566617
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106566617
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     106566617
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     106566617
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 106566617
NCBI-ProteinID: XP_013990280
UniProt: A0A1S3LHG8
LinkDB
Position
ssa01
AA seq 154 aa
MTLEEVLIQKFAERAQCTGKALEEVLLSAKENDCLTVGVYESAKVMNVVPDSVSFCVLAT
DEEWECDIALQIHFTLIQSFCFDNDISIVRVNDMQRLAEIVGDKTVQLEDAHCCLITNPV
DGSWEDAALEKLHLFCEESRSLNDWVPEITLLER
NT seq 465 nt   +upstreamnt  +downstreamnt
atgactcttgaggaagttctgatccagaagttcgctgagcgtgcccagtgcaccggcaaa
gcactagaggaagttttgctctctgctaaagaaaatgactgcctgacagttggtgtctac
gagtctgctaaagttatgaatgttgttccagacagcgtgtctttctgcgttctggccacc
gatgaggagtgggagtgtgacattgctctccagatccacttcaccctcatccagtctttc
tgttttgacaacgacatcagcatcgtcagagtgaacgacatgcagcgcctggccgagatt
gttggggacaagactgtccagcttgaagatgcccactgctgtcttatcacgaacccagtt
gatggttcttgggaggatgctgctctggagaagctgcacctgttctgtgaggagagccgc
agtctgaacgactgggttccagagatcacccttcttgagcgctga

KEGG   Salmo salar (Atlantic salmon): 106567216
Entry
106567216         CDS       T04363                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106567216
   04068 FoxO signaling pathway
    106567216
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106567216
   04210 Apoptosis
    106567216
   04115 p53 signaling pathway
    106567216
   04218 Cellular senescence
    106567216
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106567216
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     106567216
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     106567216
SSDB
Motif
Pfam: Ribosomal_L7Ae CpXC
Other DBs
NCBI-GeneID: 106567216
NCBI-ProteinID: XP_013991719
UniProt: A0A1S3LMG8
LinkDB
Position
ssa01
AA seq 140 aa
MEAIGKSLKEALKSAQCEDCLTVGVYESAKIMNDDPDSVSFCVLATDEEWECDIALQIHF
TLIQSFCFDNDISIVRVNDMQRLAEIVGDKTVQLEDAHCCLITNPVDGSCEDAALEKLHL
FCEESRSLNDWVPEITLLER
NT seq 423 nt   +upstreamnt  +downstreamnt
atggaagctattggcaaatctctgaaggaagctctcaagtctgcccagtgtgaggattgc
ctcactgttggtgtctatgagagtgccaaaataatgaatgatgatccagacagcgtgtct
ttttgtgtcctggccaccgatgaggagtgggagtgtgacattgctctccagatccacttc
accctcatccagtctttctgttttgacaacgacatcagcatcgtcagagtgaacgacatg
cagcgcctggctgagattgttggggacaagactgtccagcttgaagatgcccactgctgt
cttatcacgaacccagttgatggttcttgcgaggatgctgctctggagaagctgcacctg
ttctgtgaggagagccgcagtctgaacgactgggttccagagatcacccttcttgagcgc
tga

KEGG   Salmo salar (Atlantic salmon): 106568974
Entry
106568974         CDS       T04363                                 

Gene name
GA45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106568974 (GA45A)
   04068 FoxO signaling pathway
    106568974 (GA45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106568974 (GA45A)
   04210 Apoptosis
    106568974 (GA45A)
   04115 p53 signaling pathway
    106568974 (GA45A)
   04218 Cellular senescence
    106568974 (GA45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106568974 (GA45A)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     106568974 (GA45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     106568974 (GA45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 106568974
NCBI-ProteinID: XP_013995364
UniProt: B9EQ49
LinkDB
Position
ssa14
AA seq 159 aa
MCKMTFEELSGDYSAERMDTVAKALEEVLSLALPQGCITVGVYEAAKSLNVDPDNVVLCI
LATDDEDVKDVALQIHFTLIQAFCCENDISILRVNNTRRLAEILGGGTQGGEPMDLHCVL
VTSPHSSSWKDPALSKVNRFCRESRCMDQWVPIINLPER
NT seq 480 nt   +upstreamnt  +downstreamnt
atgtgcaaaatgacatttgaggaactaagtggggattattctgcagaaaggatggataca
gtggcaaaagcattggaagaggttctctcattggcattaccccaaggatgcataacagta
ggggtctatgaagcagcaaaatcattgaatgtagatccagataatgtggttctgtgcatc
ctggctacagatgacgaggatgtaaaggacgtggcccttcagatccacttcaccctgatc
caggcattctgctgtgagaatgacatcagcatcctgcgagttaacaacaccaggcgtctg
gcagagatcctcggcggagggacacaggggggagagcccatggatctgcactgtgtcctg
gtcactagcccacactcctcctcctggaaagacccagccctgagcaaagtgaaccgcttc
tgcagggagagccggtgcatggaccagtgggtacccatcattaacctccctgagcgatga

KEGG   Salmo salar (Atlantic salmon): 106573930
Entry
106573930         CDS       T04363                                 

Gene name
GA45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106573930 (GA45B)
   04068 FoxO signaling pathway
    106573930 (GA45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106573930 (GA45B)
   04210 Apoptosis
    106573930 (GA45B)
   04115 p53 signaling pathway
    106573930 (GA45B)
   04218 Cellular senescence
    106573930 (GA45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106573930 (GA45B)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     106573930 (GA45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     106573930 (GA45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 106573930
NCBI-ProteinID: XP_014004869
UniProt: B5X8I1
LinkDB
Position
ssa16
AA seq 160 aa
MTLEELGCNITEKKMETVSQALEELLVAAQQQDCLTLGVYESAKLMNVDPDSVVLCVLAT
DEEDEDDIALQIHFTLIQAFCCDNDINILRVSGIRRLAQVLGEPSTADSNGNEPKDLHCI
LVTNTQCQSLKCQALQDVGNYCEESRCKNQWVPYLALQER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgactctggaagaactgggatgcaatatcactgagaaaaagatggagaccgtgagtcaa
gctctagaagagctgctggtggcagcgcagcaacaagactgcctgactttgggagtctac
gagtctgcaaaactgatgaatgttgatcctgatagtgtagtcttgtgtgttctggcgact
gatgaggaagacgaggatgacatcgcactgcagattcacttcacgctcatccaagccttc
tgctgcgacaacgacatcaacatactgagagtctcgggcatcaggcgcctcgctcaggtt
cttggcgagccaagcaccgctgacagcaacggcaacgagcccaaagatctgcactgcatc
cttgtcactaacacccagtgccaatctctgaaatgccaagcgttgcaggacgtgggcaac
tactgcgaggagagccgctgcaagaaccagtgggtgccttatctggccctgcaggagcgc
tga

KEGG   Salmo salar (Atlantic salmon): 106584172
Entry
106584172         CDS       T04363                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106584172
   04068 FoxO signaling pathway
    106584172
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106584172
   04210 Apoptosis
    106584172
   04115 p53 signaling pathway
    106584172
   04218 Cellular senescence
    106584172
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106584172
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     106584172
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     106584172
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 106584172
NCBI-ProteinID: XP_014024594
UniProt: A0A1S3PAJ9
LinkDB
Position
ssa23
AA seq 157 aa
MCNMTFEETSGENSTERMDSVSKALEEVISSALPQGCVTIGVYEAAKSLNVDPDNVVLCL
LATDEEQVEDVALQIHFTLIQAFCCENDINILRVSNMRRLAEILGGVKPGDEPMDLHCVL
VTKSTTCKDPALSKVNRFCRDSRILDQWVPIINLPDR
NT seq 474 nt   +upstreamnt  +downstreamnt
atgtgcaatatgacttttgaggaaaccagtggagaaaactctacagaaaggatggattct
gtgtctaaagcattggaggaggtcatcagctctgcgttaccccaaggttgcgtcactata
ggagtctacgaggcagcaaagtccctcaatgtggacccggataatgtggtactgtgcctc
ttggccacagatgaggagcaggtcgaggacgtggctttacagatccacttcaccctgatt
caggcgttctgctgcgagaacgacatcaacatcctgcgggtcagcaacatgaggcgcctc
gctgagatccttggaggagtgaagcctggagacgagcccatggacctgcactgtgtgcta
gttactaagtcaaccacgtgcaaggacccagctctgagcaaagtgaatcgcttctgtaga
gacagtcgaatactggaccagtgggtccccatcatcaacttacctgaccggtga

KEGG   Salmo salar (Atlantic salmon): 106585195
Entry
106585195         CDS       T04363                                 

Gene name
GA45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106585195 (GA45G)
   04068 FoxO signaling pathway
    106585195 (GA45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106585195 (GA45G)
   04210 Apoptosis
    106585195 (GA45G)
   04115 p53 signaling pathway
    106585195 (GA45G)
   04218 Cellular senescence
    106585195 (GA45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106585195 (GA45G)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     106585195 (GA45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     106585195 (GA45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 106585195
NCBI-ProteinID: XP_014026604
UniProt: B9EMU6
LinkDB
Position
ssa24
AA seq 161 aa
MTLELEEIRGQENALDTTDRVQIAGTALEELLVSAKKQDYLTVGVYESAKVMNVDADNVA
FCVLATDEEYECDIALQIHFTLIQAFCFDNYINVVRVNDIERLADLVGTDETGEPKDAHC
ILVTSPGAGSWKDPALDKLHLFCEESRSVYDWVPTITLPER
NT seq 486 nt   +upstreamnt  +downstreamnt
atgactctggaactggaagagatccgtggacaggagaacgcactcgataccaccgataga
gtgcaaattgcaggcacagccctggaggagctgttggtgtctgcaaagaaacaggactat
cttaccgtgggagtctacgagtctgccaaagttatgaatgttgacgcagacaatgtggca
ttctgcgttctggcgacagacgaggagtacgaatgcgacatcgcgctccagatccacttc
accctcatccaggcgttctgcttcgataactacatcaacgtggtgcgcgttaacgacatc
gagcgcctggctgacctcgtgggcacggacgaaactggggaacccaaggacgcacattgc
attcttgtcacgagccctggtgctggatcgtggaaagaccctgctttggacaaactgcat
ctgttctgtgaggagagccgcagtgtgtatgactgggttcccaccatcaccctacctgaa
cgctga

KEGG   Salmo salar (Atlantic salmon): 106598934
Entry
106598934         CDS       T04363                                 

Gene name
GA45A
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106598934 (GA45A)
   04068 FoxO signaling pathway
    106598934 (GA45A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106598934 (GA45A)
   04210 Apoptosis
    106598934 (GA45A)
   04115 p53 signaling pathway
    106598934 (GA45A)
   04218 Cellular senescence
    106598934 (GA45A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106598934 (GA45A)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     106598934 (GA45A)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     106598934 (GA45A)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 106598934
NCBI-ProteinID: XP_014045437
UniProt: B9ELG3
LinkDB
Position
ssa03
AA seq 160 aa
MCKMTFEELSGEYSTERMDTVTKALEEVLSSALPQGCITVGVYEAAKSLNVDPDNVVLCI
LATDDEDVKDVALQIHFTLIQAFCCENDINILRVNNTRRLAEILGGGGKQGGEPMDLHCV
LVTSPHSSSWKDPALSKVNRFCRESRCMDQWVPIINLPER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtgcaagatgacatttgaggaactaagtggggaatattctacagaaaggatggataca
gtgacaaaagccttggaagaggttctctcatcagcattaccccaaggatgcataacagta
ggggtctatgaagcagctaaatcattgaatgtagatccagataatgtggttctgtgcatc
ctggctacggatgacgaggatgtaaaggacgtggcccttcagatccacttcaccctgatc
caggcattctgctgtgagaatgacatcaacatcctgcgagtgaacaacacccggcgtctg
gcagagatccttggagggggagggaaacaagggggagagcccatggacctgcactgtgtc
ctggtcacaagcccacactcctcgtcctggaaagacccagccctgagcaaagtgaaccgc
ttctgcagggagagccgttgcatggaccagtgggtgcccatcattaacctcccagagcgc
tga

KEGG   Salmo salar (Atlantic salmon): 106613608
Entry
106613608         CDS       T04363                                 

Gene name
GA45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106613608 (GA45B)
   04068 FoxO signaling pathway
    106613608 (GA45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106613608 (GA45B)
   04210 Apoptosis
    106613608 (GA45B)
   04115 p53 signaling pathway
    106613608 (GA45B)
   04218 Cellular senescence
    106613608 (GA45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106613608 (GA45B)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     106613608 (GA45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     106613608 (GA45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 106613608
NCBI-ProteinID: XP_014071517
UniProt: B5XER1
LinkDB
Position
ssa10
AA seq 158 aa
MTLEELVGCNITEKKMETVNQALEELLVAAQQQDCLTVGVYESAKLMNVDPDSVVLCVLA
TDEDVIPLQIHFTLIQAFCCDNDINILRVSGMRRLAQVLGEPSTADSNGNEPNDLHCILV
TNTQCQSLKCQALQDVSNYCEESRCKNQWVPYLSLQER
NT seq 477 nt   +upstreamnt  +downstreamnt
atgactctggaagaactcgttggatgcaatatcactgagaaaaagatggagaccgtgaat
caagcactagaagagctgctggtggcagcgcagcaacaagactgcctgactgtgggagtc
tacgagtctgcaaaactgatgaatgttgatcctgacagtgttgtgttgtgtgttctggcg
actgacgaggatgtcattccactgcagattcacttcacgctcatccaagccttctgttgc
gacaacgacatcaacatactgcgtgtctccggcatgaggcgcctcgctcaggttcttggc
gagccaagcaccgctgacagcaacggcaacgagcccaatgatctgcactgcatccttgtc
actaacacccagtgccagtctctgaaatgccaagcgttgcaggatgtcagcaactactgc
gaggagagccgctgcaagaaccaatgggtaccttacctgtccctgcaggagcgctga

DBGET integrated database retrieval system