KEGG   Salmo salar (Atlantic salmon): 100196490Help
Entry
100196490         CDS       T04363                                 

Gene name
act
Definition
(RefSeq) Actin, adductor muscle
  KO
K05692  actin beta/gamma 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04145  Phagosome
sasa04210  Apoptosis
sasa04510  Focal adhesion
sasa04520  Adherens junction
sasa04530  Tight junction
sasa04810  Regulation of actin cytoskeleton
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100196490 (act)
  09143 Cell growth and death
   04210 Apoptosis
    100196490 (act)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100196490 (act)
   04520 Adherens junction
    100196490 (act)
   04530 Tight junction
    100196490 (act)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100196490 (act)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100196490 (act)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:sasa03021]
    100196490 (act)
   03019 Messenger RNA biogenesis [BR:sasa03019]
    100196490 (act)
   03036 Chromosome and associated proteins [BR:sasa03036]
    100196490 (act)
   03029 Mitochondrial biogenesis [BR:sasa03029]
    100196490 (act)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sasa04812]
    100196490 (act)
   04147 Exosome [BR:sasa04147]
    100196490 (act)
Transcription machinery [BR:sasa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     100196490 (act)
Messenger RNA biogenesis [BR:sasa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100196490 (act)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TIP60 complex
     100196490 (act)
    NuA4 complex
     100196490 (act)
  Chromatin remodeling factors
   BAF complex
    100196490 (act)
   PBAF complex
    100196490 (act)
   SWR1 complex
    100196490 (act)
Mitochondrial biogenesis [BR:sasa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Actin cytoskeleton organization
    100196490 (act)
Cytoskeleton proteins [BR:sasa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     100196490 (act)
Exosome [BR:sasa04147]
 Exosomal proteins
  Proteins found in most exosomes
   100196490 (act)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Actin GerD
Motif
Other DBs
NCBI-GeneID: 100196490
NCBI-ProteinID: NP_001134991
UniProt: B5XFZ3
LinkDB All DBs
AA seq 376 aa AA seqDB search
MVEDEVAALVIDNGSGMCKSGFAGDDAPRAVFPSIVGRPRHVGIMVGMGQKDSYVGDEAQ
SKRGILSLKYPIDHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKNNREKM
TQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAVLRLD
LAGRDLTDYLMKVLTERGYSFTTTAEREIVRDVKEKLCYVALDYTNELAVAGSSSSLEKS
YELPDGQVITIGSERFRCPEALFQPALIGMEAVGIHETAYNSIMKCDVDIRKDLYANTVL
SGGSTMFSGIADRMQKEVSALAPTTMKIKIISPPERKYSVWIGGSILASLSTFQQMWISK
MEYDESGPAIVHRKCF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggtagaggatgaggttgctgcacttgttatagataatggatctgggatgtgtaaatcg
gggttcgcaggcgacgatgcaccaagagctgtgtttccgagcatagttggaagaccgagg
cacgttggcataatggttggaatgggtcagaaggattcgtatgtgggagatgaggcgcag
tccaagcgagggatcctctcgttgaagtatcctatcgaccacgggattgtgaccaactgg
gatgacatggaaaagatatggcaccacacattctacaacgagttacgggtggctcccgag
gagcatccagtgcttctgaccgaggctccactcaaccccaaaaacaaccgcgagaaaatg
acccaaataatgttcgaaacattcaactcgccagcaatgtacgtagctatccaagcggtt
ttatcgctctacgctagcggtcggactactgggattgttttggattcaggcgacggcgtc
acccacaccgttcccatatatgaaggatacgcgttaccgcatgcagttttgcgtttggat
ctcgctggaagagacctcaccgattacctcatgaaggtgctcaccgagcgtggctacagc
ttcacaaccacagccgaaagagagattgtgagagacgtcaaagagaaattgtgttacgtt
gcgctggactataccaacgagttggctgttgcaggatcgagctcgtcgctggaaaagagt
tacgagctgcccgacggccaggtcatcacgattggaagtgaacgttttaggtgtcctgag
gcgcttttccagcccgcactcattggcatggaagccgtaggaatacacgaaactgcgtac
aattccatcatgaaatgcgacgttgatattagaaaagacctgtacgcaaacaccgtacta
tcgggcggctccaccatgttctccggcatcgcagatcggatgcaaaaagaagtcagtgct
cttgcccctaccacaatgaaaataaaaattatctcgccaccagaaagaaaatactcagtt
tggataggaggctccattctcgcctcgttgtccacttttcagcagatgtggatatccaaa
atggagtatgacgaatccggccctgctattgttcacagaaaatgcttctaa

DBGET integrated database retrieval system