Salmo salar (Atlantic salmon): 100196603 Help Entry 100196603         CDS       T04363                                  Gene name rash Definition (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04012   ErbB signaling pathway sasa04068   FoxO signaling pathway sasa04137   Mitophagy - animal sasa04140   Autophagy - animal sasa04144   Endocytosis sasa04150   mTOR signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence sasa04370   VEGF signaling pathway sasa04371   Apelin signaling pathway sasa04510   Focal adhesion sasa04540   Gap junction sasa04625   C-type lectin receptor signaling pathway sasa04810   Regulation of actin cytoskeleton sasa04910   Insulin signaling pathway sasa04912   GnRH signaling pathway sasa04916   Melanogenesis sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100196603 (rash)    04012 ErbB signaling pathway     100196603 (rash)    04370 VEGF signaling pathway     100196603 (rash)    04371 Apelin signaling pathway     100196603 (rash)    04068 FoxO signaling pathway     100196603 (rash)    04150 mTOR signaling pathway     100196603 (rash)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100196603 (rash)    04140 Autophagy - animal     100196603 (rash)    04137 Mitophagy - animal     100196603 (rash)   09143 Cell growth and death    04210 Apoptosis     100196603 (rash)    04218 Cellular senescence     100196603 (rash)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100196603 (rash)    04540 Gap junction     100196603 (rash)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100196603 (rash)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100196603 (rash)   09152 Endocrine system    04910 Insulin signaling pathway     100196603 (rash)    04912 GnRH signaling pathway     100196603 (rash)    04916 Melanogenesis     100196603 (rash)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100196603 (rash)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     100196603 (rash)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     100196603 (rash)    04031 GTP-binding proteins [BR:sasa04031]     100196603 (rash) Membrane trafficking [BR:sasa04131]  Endocytosis   Macropinocytosis    Ras GTPases     100196603 (rash) Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    100196603 (rash)   Exosomal proteins of colorectal cancer cells    100196603 (rash) GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100196603 (rash) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA ATP_bind_1 Septin AAA_25 Motif Other DBs NCBI-GeneID:  100196603 NCBI-ProteinID:  NP_001135104 UniProt:  B5X1B6 LinkDB All DBs Position ssa10 AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PSRTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagttggtggtggtgggggctggaggtgtggggaagagtgcactcacc atccagctcatccagaaccactttgtggatgaatacgaccccaccatagaggactcatac aggaagcaggtggtgattgacggggagacatgtctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgt gtcttcgccatcaacaacaccaagtccttcgaggacatccaccagtacagggaacagatc aagcgtgtgaaagactctgatgacgtgcccatggtcctggtgggtaataaatgtgacctc ccatcgcgtaccgtggacacgcggcaagcacaggaactggcccgcagctacggaattccc tacatcgagacctctgccaagacacgacagggggtagaggacgccttctacacgttagtg agagagatcaggcagcacaagctgaggaagctcaaccctccggacgagagtggacaggac tgcatgagctgccgctgtgtggtgtcgtga

Salmo salar (Atlantic salmon): 100380437 Help Entry 100380437         CDS       T04363                                  Gene name rask Definition (RefSeq) GTPase KRas   KO K07827   GTPase KRas Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04012   ErbB signaling pathway sasa04068   FoxO signaling pathway sasa04137   Mitophagy - animal sasa04140   Autophagy - animal sasa04150   mTOR signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence sasa04370   VEGF signaling pathway sasa04371   Apelin signaling pathway sasa04540   Gap junction sasa04625   C-type lectin receptor signaling pathway sasa04810   Regulation of actin cytoskeleton sasa04910   Insulin signaling pathway sasa04912   GnRH signaling pathway sasa04914   Progesterone-mediated oocyte maturation sasa04916   Melanogenesis Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100380437 (rask)    04012 ErbB signaling pathway     100380437 (rask)    04370 VEGF signaling pathway     100380437 (rask)    04371 Apelin signaling pathway     100380437 (rask)    04068 FoxO signaling pathway     100380437 (rask)    04150 mTOR signaling pathway     100380437 (rask)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100380437 (rask)    04137 Mitophagy - animal     100380437 (rask)   09143 Cell growth and death    04210 Apoptosis     100380437 (rask)    04218 Cellular senescence     100380437 (rask)   09144 Cellular community - eukaryotes    04540 Gap junction     100380437 (rask)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100380437 (rask)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100380437 (rask)   09152 Endocrine system    04910 Insulin signaling pathway     100380437 (rask)    04912 GnRH signaling pathway     100380437 (rask)    04914 Progesterone-mediated oocyte maturation     100380437 (rask)    04916 Melanogenesis     100380437 (rask)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     100380437 (rask)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:sasa04031]     100380437 (rask) Membrane trafficking [BR:sasa04131]  Endocytosis   Macropinocytosis    Ras GTPases     100380437 (rask) GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100380437 (rask) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N ATP_bind_1 Gtr1_RagA Septin CbiA AAA_25 Motif Other DBs NCBI-GeneID:  100380437 NCBI-ProteinID:  NP_001167192 UniProt:  C0HAH5 LinkDB All DBs Position ssa16 AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYSLVREIRLYRLKKLSKEEKTPRC VKLKKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatacaaactggtggtggtgggagcaggaggcgtgggcaagagcgcactcacc atccagctcatccagaaccactttgtggatgaatatgaccccaccatcgaggactcatac aggaagcaggtggtgattgacggggagacttgtctgctagacatcctggacactgcaggt caggaggagtacagcgctatgagggaccagtacatgaggacaggggagggcttcctctgt gtcttcgccatcaacaacaccaagtccttcgaggacatccaccactatagagagcagatc aagcgggtgaaagactcggaagacgtgcccatggtgctggtgggaaacaagtgtgacctg ccgtcccggacggtggacaccaaacaggctcaggacttggcgcgcagctacggcatcccc ttcatcgagacctcggccaaaaccagacagagagtggaggatgccttttacagtctggta cgggagatcaggctgtaccggctgaaaaagctcagcaaggaagaaaagaccccgcgctgc gtcaagcttaaaaagtgtgttgtgatgtga

Salmo salar (Atlantic salmon): 106561428 Help Entry 106561428         CDS       T04363                                  Definition (RefSeq) GTPase KRas   KO K07827   GTPase KRas Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04012   ErbB signaling pathway sasa04068   FoxO signaling pathway sasa04137   Mitophagy - animal sasa04140   Autophagy - animal sasa04150   mTOR signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence sasa04370   VEGF signaling pathway sasa04371   Apelin signaling pathway sasa04540   Gap junction sasa04625   C-type lectin receptor signaling pathway sasa04810   Regulation of actin cytoskeleton sasa04910   Insulin signaling pathway sasa04912   GnRH signaling pathway sasa04914   Progesterone-mediated oocyte maturation sasa04916   Melanogenesis Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106561428    04012 ErbB signaling pathway     106561428    04370 VEGF signaling pathway     106561428    04371 Apelin signaling pathway     106561428    04068 FoxO signaling pathway     106561428    04150 mTOR signaling pathway     106561428  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106561428    04137 Mitophagy - animal     106561428   09143 Cell growth and death    04210 Apoptosis     106561428    04218 Cellular senescence     106561428   09144 Cellular community - eukaryotes    04540 Gap junction     106561428   09142 Cell motility    04810 Regulation of actin cytoskeleton     106561428  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106561428   09152 Endocrine system    04910 Insulin signaling pathway     106561428    04912 GnRH signaling pathway     106561428    04914 Progesterone-mediated oocyte maturation     106561428    04916 Melanogenesis     106561428  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     106561428   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:sasa04031]     106561428 Membrane trafficking [BR:sasa04131]  Endocytosis   Macropinocytosis    Ras GTPases     106561428 GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106561428 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N ATP_bind_1 Gtr1_RagA Septin CbiA AAA_25 Motif Other DBs NCBI-GeneID:  106561428 NCBI-ProteinID:  XP_013980870 UniProt:  C0HAH5 LinkDB All DBs Position ssa10 AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYSLVREIRLYRLKKLSKEEKTPRC VKLKKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatacaagctggtggtggtgggagcaggaggcgtgggcaagagcgcgctcacc atccagctcattcagaaccactttgtggatgaatatgaccccaccatcgaggactcgtac aggaagcaggtggtgattgatggggagacgtgtctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgt gtcttcgccatcaacaacaccaagtccttcgaggacatccaccactatagagagcagatc aagcgggtgaaagactcagaagacgtgcccatggtgttggtggggaacaagtgtgacctg ccgtcccggacggtagacaccaaacaggctcaggacttagcgcgcagctacggcatcccc ttcattgagacctcagccaaaacgagacagagagtggaggatgccttttacagtctggta cgggagatcaggctgtaccggctgaaaaagctcagcaaggaagaaaagaccccgcgctgc gtcaagcttaaaaagtgtgttgtgatgtga

Salmo salar (Atlantic salmon): 106573361 Help Entry 106573361         CDS       T04363                                  Definition (RefSeq) GTPase HRas-like   KO K02833   GTPase HRas Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04012   ErbB signaling pathway sasa04068   FoxO signaling pathway sasa04137   Mitophagy - animal sasa04140   Autophagy - animal sasa04144   Endocytosis sasa04150   mTOR signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence sasa04370   VEGF signaling pathway sasa04371   Apelin signaling pathway sasa04510   Focal adhesion sasa04540   Gap junction sasa04625   C-type lectin receptor signaling pathway sasa04810   Regulation of actin cytoskeleton sasa04910   Insulin signaling pathway sasa04912   GnRH signaling pathway sasa04916   Melanogenesis sasa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106573361    04012 ErbB signaling pathway     106573361    04370 VEGF signaling pathway     106573361    04371 Apelin signaling pathway     106573361    04068 FoxO signaling pathway     106573361    04150 mTOR signaling pathway     106573361  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     106573361    04140 Autophagy - animal     106573361    04137 Mitophagy - animal     106573361   09143 Cell growth and death    04210 Apoptosis     106573361    04218 Cellular senescence     106573361   09144 Cellular community - eukaryotes    04510 Focal adhesion     106573361    04540 Gap junction     106573361   09142 Cell motility    04810 Regulation of actin cytoskeleton     106573361  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106573361   09152 Endocrine system    04910 Insulin signaling pathway     106573361    04912 GnRH signaling pathway     106573361    04916 Melanogenesis     106573361  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     106573361  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     106573361   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sasa04147]     106573361    04031 GTP-binding proteins [BR:sasa04031]     106573361 Membrane trafficking [BR:sasa04131]  Endocytosis   Macropinocytosis    Ras GTPases     106573361 Exosome [BR:sasa04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    106573361   Exosomal proteins of colorectal cancer cells    106573361 GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106573361 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Gtr1_RagA Septin AAA_25 Motif Other DBs NCBI-GeneID:  106573361 NCBI-ProteinID:  XP_014003820 UniProt:  A0A1S3ML54 LinkDB All DBs Position ssa16 AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PACTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtacaagttggtggtggtgggggcaggaggtgtgggaaagagtgcactcacc atccagcttatccagaaccactttgtggatgaatacgaccccaccatagaggactcgtac aggaagcaggtggtgattgatggggagacatgtctgctggacatcctggacactgcaggt caggaggagtacagcgctatgagggaccagtacatgaggacaggggagggcttcctctgt gtcttcgccatcaacaacaccaagtccttcgaggacatccaccaatacagggaacagatc aagcgtgtgaaggactctgacgatgtaccgatggtgctggtgggtaataaatgtgacctc ccggcgtgtaccgtggacacgcggcaagcacaggaactggcccgcagctatggaattccc tacattgagacctcagccaagacacgacagggggtagaggatgccttctacacactagtg agagagatcagacaacacaagctgaggaagctcaaccctcctgacgagagcgggcaggac tgcatgagctgccgctgtgtggtgtcttga

Salmo salar (Atlantic salmon): 106601908 Help Entry 106601908         CDS       T04363                                  Definition (RefSeq) GTPase HRas-like   KO K07827   GTPase KRas Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04012   ErbB signaling pathway sasa04068   FoxO signaling pathway sasa04137   Mitophagy - animal sasa04140   Autophagy - animal sasa04150   mTOR signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence sasa04370   VEGF signaling pathway sasa04371   Apelin signaling pathway sasa04540   Gap junction sasa04625   C-type lectin receptor signaling pathway sasa04810   Regulation of actin cytoskeleton sasa04910   Insulin signaling pathway sasa04912   GnRH signaling pathway sasa04914   Progesterone-mediated oocyte maturation sasa04916   Melanogenesis Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106601908    04012 ErbB signaling pathway     106601908    04370 VEGF signaling pathway     106601908    04371 Apelin signaling pathway     106601908    04068 FoxO signaling pathway     106601908    04150 mTOR signaling pathway     106601908  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106601908    04137 Mitophagy - animal     106601908   09143 Cell growth and death    04210 Apoptosis     106601908    04218 Cellular senescence     106601908   09144 Cellular community - eukaryotes    04540 Gap junction     106601908   09142 Cell motility    04810 Regulation of actin cytoskeleton     106601908  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106601908   09152 Endocrine system    04910 Insulin signaling pathway     106601908    04912 GnRH signaling pathway     106601908    04914 Progesterone-mediated oocyte maturation     106601908    04916 Melanogenesis     106601908  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     106601908   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:sasa04031]     106601908 Membrane trafficking [BR:sasa04131]  Endocytosis   Macropinocytosis    Ras GTPases     106601908 GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106601908 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 FeoB_N Septin SatRNA_48 Motif Other DBs NCBI-GeneID:  106601908 NCBI-ProteinID:  XP_014049814 UniProt:  A0A1S3S165 LinkDB All DBs Position ssa03 AA seq 187 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNIKSFEDVHLYREQINRVKDSDSVPMVLVGNKSDL GSRSVESRQAQELARGYGVPFVETSAKTRQGVEEAFYSLVREIRRYKETNRSNKKSKKST QRRCTIL NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataagcttgttgtggtgggtgctggaggtgttgggaagagtgccttaact atccagctcatccagaatcactttgtggatgaatatgaccccaccattgaggactcgtac aggaagcaggtggtgattgacggagagacgtgtctgctggacatccttgacactgcaggt caagaggagtacagcgccatgagggaccagtacatgaggacaggggaaggcttcctctgt gtgttcgccatcaacaacatcaagtcctttgaggacgttcacctgtacagagaacagatc aacagggtgaaggacagtgacagtgtgcctatggtgctggtggggaacaagagtgacctg gggagtcggagcgtggagagcaggcaggctcaggagctggcccgcggctatggtgtgccc ttcgtggagacctctgccaaaaccagacagggagtggaggaggcgttctactctctagtc agggagatcaggaggtataaggaaaccaaccgcagcaacaagaagagcaagaaaagcact cagagacgttgcaccattctataa

Salmo salar (Atlantic salmon): 106606379 Help Entry 106606379         CDS       T04363                                  Definition (RefSeq) GTPase HRas-like   KO K07827   GTPase KRas Organism sasa  Salmo salar (Atlantic salmon) Pathway sasa04010   MAPK signaling pathway sasa04012   ErbB signaling pathway sasa04068   FoxO signaling pathway sasa04137   Mitophagy - animal sasa04140   Autophagy - animal sasa04150   mTOR signaling pathway sasa04210   Apoptosis sasa04218   Cellular senescence sasa04370   VEGF signaling pathway sasa04371   Apelin signaling pathway sasa04540   Gap junction sasa04625   C-type lectin receptor signaling pathway sasa04810   Regulation of actin cytoskeleton sasa04910   Insulin signaling pathway sasa04912   GnRH signaling pathway sasa04914   Progesterone-mediated oocyte maturation sasa04916   Melanogenesis Brite KEGG Orthology (KO) [BR:sasa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     106606379    04012 ErbB signaling pathway     106606379    04370 VEGF signaling pathway     106606379    04371 Apelin signaling pathway     106606379    04068 FoxO signaling pathway     106606379    04150 mTOR signaling pathway     106606379  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     106606379    04137 Mitophagy - animal     106606379   09143 Cell growth and death    04210 Apoptosis     106606379    04218 Cellular senescence     106606379   09144 Cellular community - eukaryotes    04540 Gap junction     106606379   09142 Cell motility    04810 Regulation of actin cytoskeleton     106606379  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     106606379   09152 Endocrine system    04910 Insulin signaling pathway     106606379    04912 GnRH signaling pathway     106606379    04914 Progesterone-mediated oocyte maturation     106606379    04916 Melanogenesis     106606379  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sasa04131]     106606379   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:sasa04031]     106606379 Membrane trafficking [BR:sasa04131]  Endocytosis   Macropinocytosis    Ras GTPases     106606379 GTP-binding proteins [BR:sasa04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     106606379 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 FeoB_N Septin SatRNA_48 Motif Other DBs NCBI-GeneID:  106606379 NCBI-ProteinID:  XP_014058006 UniProt:  A0A1S3S165 LinkDB All DBs Position ssa06 AA seq 187 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNIKSFEDVHLYREQINRVKDSDSVPMVLVGNKSDL GSRSVESRQAQELARGYGVPFVETSAKTRQGVEEAFYSLVREIRRYKETNRSNKKSKKST QRRCTIL NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgactgagtataagcttgttgtggtgggtgctggaggtgttgggaagagtgccttaact atccagctcatccagaatcactttgtggatgaatatgaccccaccatcgaggactcgtac aggaagcaggtggtgattgacggagagacgtgtctgctggacatccttgacactgcaggt caagaggagtacagcgccatgagggaccagtacatgaggacaggggaaggcttcctctgt gtgttcgccatcaacaacatcaagtcctttgaggacgttcacctgtacagagaacagatc aacagggtgaaggacagtgacagtgtgcctatggtgctggtggggaacaagagtgacctg gggagtcggagcgtggagagcaggcaggctcaggagctggcccgcggctatggtgtgccc ttcgtggagacctctgccaaaaccagacagggagtggaggaggcgttctactctctagtc agggagatcaggaggtataaggaaaccaaccgcagcaacaagaagagcaagaaaagcact cagagacgttgcaccattctataa

DBGET integrated database retrieval system