KEGG   Salmo salar (Atlantic salmon): 100196603
Entry
100196603         CDS       T04363                                 

Gene name
rash
Definition
(RefSeq) GTPase HRas
  KO
K02833  GTPase HRas
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04144  Endocytosis
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04916  Melanogenesis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100196603 (rash)
   04012 ErbB signaling pathway
    100196603 (rash)
   04370 VEGF signaling pathway
    100196603 (rash)
   04371 Apelin signaling pathway
    100196603 (rash)
   04068 FoxO signaling pathway
    100196603 (rash)
   04150 mTOR signaling pathway
    100196603 (rash)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100196603 (rash)
   04140 Autophagy - animal
    100196603 (rash)
   04137 Mitophagy - animal
    100196603 (rash)
  09143 Cell growth and death
   04210 Apoptosis
    100196603 (rash)
   04218 Cellular senescence
    100196603 (rash)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100196603 (rash)
   04540 Gap junction
    100196603 (rash)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100196603 (rash)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100196603 (rash)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100196603 (rash)
   04912 GnRH signaling pathway
    100196603 (rash)
   04916 Melanogenesis
    100196603 (rash)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100196603 (rash)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    100196603 (rash)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    100196603 (rash)
   04031 GTP-binding proteins [BR:sasa04031]
    100196603 (rash)
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100196603 (rash)
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100196603 (rash)
  Exosomal proteins of colorectal cancer cells
   100196603 (rash)
GTP-binding proteins [BR:sasa04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100196603 (rash)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Gtr1_RagA ATP_bind_1 Septin AAA_25
Other DBs
NCBI-GeneID: 100196603
NCBI-ProteinID: NP_001135104
UniProt: B5X1B6
LinkDB
Position
ssa10
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PSRTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD
CMSCRCVVS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtacaagttggtggtggtgggggctggaggtgtggggaagagtgcactcacc
atccagctcatccagaaccactttgtggatgaatacgaccccaccatagaggactcatac
aggaagcaggtggtgattgacggggagacatgtctgctggacatcctggacactgcaggt
caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgt
gtcttcgccatcaacaacaccaagtccttcgaggacatccaccagtacagggaacagatc
aagcgtgtgaaagactctgatgacgtgcccatggtcctggtgggtaataaatgtgacctc
ccatcgcgtaccgtggacacgcggcaagcacaggaactggcccgcagctacggaattccc
tacatcgagacctctgccaagacacgacagggggtagaggacgccttctacacgttagtg
agagagatcaggcagcacaagctgaggaagctcaaccctccggacgagagtggacaggac
tgcatgagctgccgctgtgtggtgtcgtga

KEGG   Salmo salar (Atlantic salmon): 100380437
Entry
100380437         CDS       T04363                                 

Gene name
rask
Definition
(RefSeq) GTPase KRas
  KO
K07827  GTPase KRas
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04540  Gap junction
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100380437 (rask)
   04012 ErbB signaling pathway
    100380437 (rask)
   04370 VEGF signaling pathway
    100380437 (rask)
   04371 Apelin signaling pathway
    100380437 (rask)
   04068 FoxO signaling pathway
    100380437 (rask)
   04150 mTOR signaling pathway
    100380437 (rask)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100380437 (rask)
   04137 Mitophagy - animal
    100380437 (rask)
  09143 Cell growth and death
   04210 Apoptosis
    100380437 (rask)
   04218 Cellular senescence
    100380437 (rask)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100380437 (rask)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100380437 (rask)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100380437 (rask)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100380437 (rask)
   04912 GnRH signaling pathway
    100380437 (rask)
   04914 Progesterone-mediated oocyte maturation
    100380437 (rask)
   04916 Melanogenesis
    100380437 (rask)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    100380437 (rask)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:sasa04031]
    100380437 (rask)
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100380437 (rask)
GTP-binding proteins [BR:sasa04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100380437 (rask)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N ATP_bind_1 Gtr1_RagA Septin CbiA AAA_25
Other DBs
NCBI-GeneID: 100380437
NCBI-ProteinID: NP_001167192
UniProt: C0HAH5
LinkDB
Position
ssa16
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYSLVREIRLYRLKKLSKEEKTPRC
VKLKKCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgaccgaatacaaactggtggtggtgggagcaggaggcgtgggcaagagcgcactcacc
atccagctcatccagaaccactttgtggatgaatatgaccccaccatcgaggactcatac
aggaagcaggtggtgattgacggggagacttgtctgctagacatcctggacactgcaggt
caggaggagtacagcgctatgagggaccagtacatgaggacaggggagggcttcctctgt
gtcttcgccatcaacaacaccaagtccttcgaggacatccaccactatagagagcagatc
aagcgggtgaaagactcggaagacgtgcccatggtgctggtgggaaacaagtgtgacctg
ccgtcccggacggtggacaccaaacaggctcaggacttggcgcgcagctacggcatcccc
ttcatcgagacctcggccaaaaccagacagagagtggaggatgccttttacagtctggta
cgggagatcaggctgtaccggctgaaaaagctcagcaaggaagaaaagaccccgcgctgc
gtcaagcttaaaaagtgtgttgtgatgtga

KEGG   Salmo salar (Atlantic salmon): 106561428
Entry
106561428         CDS       T04363                                 

Definition
(RefSeq) GTPase KRas
  KO
K07827  GTPase KRas
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04540  Gap junction
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106561428
   04012 ErbB signaling pathway
    106561428
   04370 VEGF signaling pathway
    106561428
   04371 Apelin signaling pathway
    106561428
   04068 FoxO signaling pathway
    106561428
   04150 mTOR signaling pathway
    106561428
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106561428
   04137 Mitophagy - animal
    106561428
  09143 Cell growth and death
   04210 Apoptosis
    106561428
   04218 Cellular senescence
    106561428
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106561428
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106561428
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106561428
  09152 Endocrine system
   04910 Insulin signaling pathway
    106561428
   04912 GnRH signaling pathway
    106561428
   04914 Progesterone-mediated oocyte maturation
    106561428
   04916 Melanogenesis
    106561428
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106561428
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:sasa04031]
    106561428
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    106561428
GTP-binding proteins [BR:sasa04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    106561428
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 G-alpha FeoB_N ATP_bind_1 Gtr1_RagA Septin CbiA AAA_25
Other DBs
NCBI-GeneID: 106561428
NCBI-ProteinID: XP_013980870
UniProt: C0HAH5
LinkDB
Position
ssa10
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYSLVREIRLYRLKKLSKEEKTPRC
VKLKKCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacagaatacaagctggtggtggtgggagcaggaggcgtgggcaagagcgcgctcacc
atccagctcattcagaaccactttgtggatgaatatgaccccaccatcgaggactcgtac
aggaagcaggtggtgattgatggggagacgtgtctgctggacatcctggacactgcaggt
caggaggagtacagcgccatgagggaccagtacatgaggacaggggagggcttcctctgt
gtcttcgccatcaacaacaccaagtccttcgaggacatccaccactatagagagcagatc
aagcgggtgaaagactcagaagacgtgcccatggtgttggtggggaacaagtgtgacctg
ccgtcccggacggtagacaccaaacaggctcaggacttagcgcgcagctacggcatcccc
ttcattgagacctcagccaaaacgagacagagagtggaggatgccttttacagtctggta
cgggagatcaggctgtaccggctgaaaaagctcagcaaggaagaaaagaccccgcgctgc
gtcaagcttaaaaagtgtgttgtgatgtga

KEGG   Salmo salar (Atlantic salmon): 106573361
Entry
106573361         CDS       T04363                                 

Definition
(RefSeq) GTPase HRas-like
  KO
K02833  GTPase HRas
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04144  Endocytosis
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04916  Melanogenesis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106573361
   04012 ErbB signaling pathway
    106573361
   04370 VEGF signaling pathway
    106573361
   04371 Apelin signaling pathway
    106573361
   04068 FoxO signaling pathway
    106573361
   04150 mTOR signaling pathway
    106573361
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106573361
   04140 Autophagy - animal
    106573361
   04137 Mitophagy - animal
    106573361
  09143 Cell growth and death
   04210 Apoptosis
    106573361
   04218 Cellular senescence
    106573361
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106573361
   04540 Gap junction
    106573361
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106573361
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106573361
  09152 Endocrine system
   04910 Insulin signaling pathway
    106573361
   04912 GnRH signaling pathway
    106573361
   04916 Melanogenesis
    106573361
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106573361
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106573361
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106573361
   04031 GTP-binding proteins [BR:sasa04031]
    106573361
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    106573361
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106573361
  Exosomal proteins of colorectal cancer cells
   106573361
GTP-binding proteins [BR:sasa04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    106573361
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Gtr1_RagA Septin AAA_25
Other DBs
NCBI-GeneID: 106573361
NCBI-ProteinID: XP_014003820
UniProt: A0A1S3ML54
LinkDB
Position
ssa16
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
PACTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD
CMSCRCVVS
NT seq 570 nt   +upstreamnt  +downstreamnt
atgacggagtacaagttggtggtggtgggggcaggaggtgtgggaaagagtgcactcacc
atccagcttatccagaaccactttgtggatgaatacgaccccaccatagaggactcgtac
aggaagcaggtggtgattgatggggagacatgtctgctggacatcctggacactgcaggt
caggaggagtacagcgctatgagggaccagtacatgaggacaggggagggcttcctctgt
gtcttcgccatcaacaacaccaagtccttcgaggacatccaccaatacagggaacagatc
aagcgtgtgaaggactctgacgatgtaccgatggtgctggtgggtaataaatgtgacctc
ccggcgtgtaccgtggacacgcggcaagcacaggaactggcccgcagctatggaattccc
tacattgagacctcagccaagacacgacagggggtagaggatgccttctacacactagtg
agagagatcagacaacacaagctgaggaagctcaaccctcctgacgagagcgggcaggac
tgcatgagctgccgctgtgtggtgtcttga

KEGG   Salmo salar (Atlantic salmon): 106601908
Entry
106601908         CDS       T04363                                 

Definition
(RefSeq) GTPase HRas-like
  KO
K07827  GTPase KRas
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04540  Gap junction
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106601908
   04012 ErbB signaling pathway
    106601908
   04370 VEGF signaling pathway
    106601908
   04371 Apelin signaling pathway
    106601908
   04068 FoxO signaling pathway
    106601908
   04150 mTOR signaling pathway
    106601908
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106601908
   04137 Mitophagy - animal
    106601908
  09143 Cell growth and death
   04210 Apoptosis
    106601908
   04218 Cellular senescence
    106601908
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106601908
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106601908
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106601908
  09152 Endocrine system
   04910 Insulin signaling pathway
    106601908
   04912 GnRH signaling pathway
    106601908
   04914 Progesterone-mediated oocyte maturation
    106601908
   04916 Melanogenesis
    106601908
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106601908
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:sasa04031]
    106601908
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    106601908
GTP-binding proteins [BR:sasa04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    106601908
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 FeoB_N Septin SatRNA_48
Other DBs
NCBI-GeneID: 106601908
NCBI-ProteinID: XP_014049814
UniProt: A0A1S3S165
LinkDB
Position
ssa03
AA seq 187 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNIKSFEDVHLYREQINRVKDSDSVPMVLVGNKSDL
GSRSVESRQAQELARGYGVPFVETSAKTRQGVEEAFYSLVREIRRYKETNRSNKKSKKST
QRRCTIL
NT seq 564 nt   +upstreamnt  +downstreamnt
atgactgagtataagcttgttgtggtgggtgctggaggtgttgggaagagtgccttaact
atccagctcatccagaatcactttgtggatgaatatgaccccaccattgaggactcgtac
aggaagcaggtggtgattgacggagagacgtgtctgctggacatccttgacactgcaggt
caagaggagtacagcgccatgagggaccagtacatgaggacaggggaaggcttcctctgt
gtgttcgccatcaacaacatcaagtcctttgaggacgttcacctgtacagagaacagatc
aacagggtgaaggacagtgacagtgtgcctatggtgctggtggggaacaagagtgacctg
gggagtcggagcgtggagagcaggcaggctcaggagctggcccgcggctatggtgtgccc
ttcgtggagacctctgccaaaaccagacagggagtggaggaggcgttctactctctagtc
agggagatcaggaggtataaggaaaccaaccgcagcaacaagaagagcaagaaaagcact
cagagacgttgcaccattctataa

KEGG   Salmo salar (Atlantic salmon): 106606379
Entry
106606379         CDS       T04363                                 

Definition
(RefSeq) GTPase HRas-like
  KO
K07827  GTPase KRas
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04540  Gap junction
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106606379
   04012 ErbB signaling pathway
    106606379
   04370 VEGF signaling pathway
    106606379
   04371 Apelin signaling pathway
    106606379
   04068 FoxO signaling pathway
    106606379
   04150 mTOR signaling pathway
    106606379
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106606379
   04137 Mitophagy - animal
    106606379
  09143 Cell growth and death
   04210 Apoptosis
    106606379
   04218 Cellular senescence
    106606379
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106606379
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106606379
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106606379
  09152 Endocrine system
   04910 Insulin signaling pathway
    106606379
   04912 GnRH signaling pathway
    106606379
   04914 Progesterone-mediated oocyte maturation
    106606379
   04916 Melanogenesis
    106606379
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106606379
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:sasa04031]
    106606379
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    106606379
GTP-binding proteins [BR:sasa04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    106606379
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase GTP_EFTU MMR_HSR1 FeoB_N Septin SatRNA_48
Other DBs
NCBI-GeneID: 106606379
NCBI-ProteinID: XP_014058006
UniProt: A0A1S3S165
LinkDB
Position
ssa06
AA seq 187 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNIKSFEDVHLYREQINRVKDSDSVPMVLVGNKSDL
GSRSVESRQAQELARGYGVPFVETSAKTRQGVEEAFYSLVREIRRYKETNRSNKKSKKST
QRRCTIL
NT seq 564 nt   +upstreamnt  +downstreamnt
atgactgagtataagcttgttgtggtgggtgctggaggtgttgggaagagtgccttaact
atccagctcatccagaatcactttgtggatgaatatgaccccaccatcgaggactcgtac
aggaagcaggtggtgattgacggagagacgtgtctgctggacatccttgacactgcaggt
caagaggagtacagcgccatgagggaccagtacatgaggacaggggaaggcttcctctgt
gtgttcgccatcaacaacatcaagtcctttgaggacgttcacctgtacagagaacagatc
aacagggtgaaggacagtgacagtgtgcctatggtgctggtggggaacaagagtgacctg
gggagtcggagcgtggagagcaggcaggctcaggagctggcccgcggctatggtgtgccc
ttcgtggagacctctgccaaaaccagacagggagtggaggaggcgttctactctctagtc
agggagatcaggaggtataaggaaaccaaccgcagcaacaagaagagcaagaaaagcact
cagagacgttgcaccattctataa

DBGET integrated database retrieval system