KEGG   Salmo salar (Atlantic salmon): 100196698
Entry
100196698         CDS       T04363                                 

Gene name
perp
Definition
(RefSeq) PERP, TP53 apoptosis effector
  KO
K10136  TP53 apoptosis effector
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100196698 (perp)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Claudin_3 Clc-like Bac_export_2 DUF3810 Amastin
Other DBs
NCBI-GeneID: 100196698
NCBI-ProteinID: NP_001135192
UniProt: B5X1B0
LinkDB
Position
ssa01
AA seq 185 aa
MFRCGLAYPRCRWIVPLLLLFAIIFDIIAIAATSGWVEDKDAMSHYASMWSQCRGRNDIW
DCKSLMEFSWAQAVAALMIIGLIILIIAFIISCIALCCTLNISLLPVIGALLFITVVIQF
IALIIYPVKFNDLIFEGRYDYTWAYGFGWGATILCIGCGILFCCLPRYEDELTGLAKTKY
IYTSA
NT seq 558 nt   +upstreamnt  +downstreamnt
atgtttcgctgtggacttgcgtatccaagatgcaggtggatcgtaccacttcttttgctt
tttgcgattatatttgacattattgcaattgctgctacttcgggatgggttgaggacaag
gacgcaatgtcccactacgcaagtatgtggagtcaatgccgaggtcggaatgacatctgg
gactgcaaatctctcatggaattctcttgggcccaggctgtggcagctcttatgatcatc
ggcctcatcatcctcatcatcgccttcatcatctcctgtatcgctctctgctgcaccctc
aacatcagccttctgcctgtcatcggggccctgctcttcatcactgtggtcattcagttc
atcgccctcatcatctacccagtcaagttcaatgacctgatcttcgagggccgctacgac
tacacctgggcctacggcttcggctggggggccaccatcctctgcatcggctgtgggatc
ctcttctgctgcctacctcgctacgaggacgagctcacgggcctcgccaagaccaaatac
atctatacctcagcttag

KEGG   Salmo salar (Atlantic salmon): 106589683
Entry
106589683         CDS       T04363                                 

Gene name
perp
Definition
(RefSeq) PERP, TP53 apoptosis effector
  KO
K10136  TP53 apoptosis effector
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106589683 (perp)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Claudin_3 Amastin Clc-like
Other DBs
NCBI-GeneID: 106589683
NCBI-ProteinID: XP_014035417
UniProt: A0A1S3Q687
LinkDB
Position
ssa28
AA seq 185 aa
MFRCGIAYPRCRWIVPLLLLFAIIFDIIAIAANSGWVEDEGAKSHYASMWTQCRGRNDNW
DCKSLMEFSWAQAVAALMIIGLIILIIAFIISCIALCCTLNISLLPVIGALLFITVVIQF
IALIIYPVKFNDLIFEGHYDYTWAYGFGWGATILTIGCGILFCCLPRYEDELTGLAKTKY
IYTSA
NT seq 558 nt   +upstreamnt  +downstreamnt
atgtttcgctgtggaattgcgtatccaagatgcaggtggatcgtaccacttcttttgctt
tttgcgattatatttgatattattgccattgctgctaactcgggatgggttgaggacgag
ggtgcaaagtcccactacgcaagtatgtggacccagtgtcgtgggcgtaatgacaactgg
gactgcaaatctctcatggaattctcttgggcccaggctgtggcagctctaatgatcatc
ggcctcatcatcctcatcatcgctttcatcatctcctgtatcgccctctgctgcaccctc
aacatcagcctgctgcccgtcattggggccttgctcttcatcactgtggtcattcagttc
attgccctcatcatctacccagtcaagttcaatgacctgatcttcgagggccactatgac
tacacctgggcctatggcttcggctggggggccaccatcctcaccatcggctgtgggatc
ctcttctgctgcctgcctcgctacgaggacgagctcacaggcctcgccaagaccaaatac
atctatacatcagcttag

DBGET integrated database retrieval system