KEGG   Salmo salar (Atlantic salmon): 100196712
Entry
100196712         CDS       T04363                                 

Gene name
cdk2
Definition
(RefSeq) cyclin dependent kinase 2
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04114  Oocyte meiosis
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100196712 (cdk2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100196712 (cdk2)
   04114 Oocyte meiosis
    100196712 (cdk2)
   04115 p53 signaling pathway
    100196712 (cdk2)
   04218 Cellular senescence
    100196712 (cdk2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100196712 (cdk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    100196712 (cdk2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sasa03032]
    100196712 (cdk2)
   03036 Chromosome and associated proteins [BR:sasa03036]
    100196712 (cdk2)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100196712 (cdk2)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100196712 (cdk2)
DNA replication proteins [BR:sasa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100196712 (cdk2)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100196712 (cdk2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase APH Kdo
Other DBs
NCBI-GeneID: 100196712
NCBI-ProteinID: NP_001135206
UniProt: B5X1T4
LinkDB
Position
ssa22
AA seq 298 aa
MESFQKVEKIGEGTYGVVYKAKNKVTGETVALKKIRLDTETEGVPSTAIREISLLKELSH
PNIVELRDVIHTENKLYLVFEFLHQDLKKFMDSSSVSGIALPLVKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAQGEIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDEVAWPGVTSMPDYKPSF
PKWARQELSKVVPPLDDDGRELLGQMLAYDPNKRISAKNALVHRFFRDVTMPMPHLRL
NT seq 897 nt   +upstreamnt  +downstreamnt
atggaatcatttcagaaagtagaaaagattggagaagggacgtacggagtggtgtataag
gcaaagaacaaagtcactggagagaccgttgccctcaagaaaatcagactagacacggaa
acagagggagtaccaagcactgccatccgagagatatcactcctcaaagagctcagccac
ccaaatattgttgagctccgtgatgtcatccacacagagaacaaactgtacctggttttt
gagttcctacatcaggacctcaagaagttcatggactcctcctcagtctctggtatcgct
ttgccactagttaagagttacctgttccagctgctacagggcctggccttctgtcactcc
cacagggttctccatcgggacctgaagccccagaacctgctcatcaatgcccagggggag
atcaagcttgctgacttcggcctggctagggctttcggggtgcctgtccgcacctacact
catgaggtggtaactctatggtaccgagctccagaaattctcttgggctgcaaatactac
tctacagctgttgacatctggagtttggggtgcatctttgctgaaatgatcactaggagg
gccttgtttccaggtgactccgagatcgatcagctgttccgaatcttccgtaccctgggt
actccggatgaggtggcctggccaggggtcacctccatgcccgactacaagccctccttc
ccaaagtgggcccggcaggagctgtccaaagtggtgccccctctggatgatgacgggaga
gagcttcttgggcaaatgctggcctatgacccaaacaagaggatatctgctaaaaatgcc
ctcgtccatcggttcttccgtgacgtcaccatgccaatgccacacctacgactgtga

KEGG   Salmo salar (Atlantic salmon): 106565437
Entry
106565437         CDS       T04363                                 

Definition
(RefSeq) cyclin-dependent kinase 2-like
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04114  Oocyte meiosis
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106565437
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106565437
   04114 Oocyte meiosis
    106565437
   04115 p53 signaling pathway
    106565437
   04218 Cellular senescence
    106565437
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    106565437
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106565437
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sasa03032]
    106565437
   03036 Chromosome and associated proteins [BR:sasa03036]
    106565437
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     106565437
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   106565437
DNA replication proteins [BR:sasa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    106565437
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106565437
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase APH Kinase-like
Other DBs
NCBI-GeneID: 106565437
NCBI-ProteinID: XP_013988051
UniProt: A0A1S3LAR0
LinkDB
Position
ssa12
AA seq 297 aa
MELFQKVEKIGEGTYGVVYKAKNKVTGETVALKKIRLDTETEGVPSTAIREISLLKELSH
PNIVKLCDVIHTENKLYLVFEFLHQDLKKFMDSSVSGISLPLVKSYLFQLLQGLAFCHSH
RVLHRDLKPQNLLINAQGEIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYS
TAVDIWSLGCIFAEMITRRALFPGDSEIDQLFRIFRTLGTPDEVAWPGVTSMPDYKPSFP
KWARQELSKVVPPLDEDGRELLRQMLSYDPNKRISAKNALVHRFFRDVTMPMPHLRL
NT seq 894 nt   +upstreamnt  +downstreamnt
atggaattatttcagaaagtggaaaagattggagaagggacgtacggggtggtgtacaag
gcaaagaacaaagtcacgggagagactgttgccctcaagaaaatcagactagacacggaa
acggagggagtaccaagcactgccatccgagagatatcgctcctcaaagagctcagccac
ccaaatattgtcaagctctgtgatgtcatccacacagagaacaaactgtacctggttttt
gagttccttcatcaggaccttaagaagttcatggactcctcggtctccggtatctctcta
ccacttgtcaagagttacctgttccagctgctgcagggcctggccttctgtcactcccac
agggttctccatcgggacctgaagccccagaacctgctcattaacgcccagggggagatc
aagctggctgacttcggcctggctagggcctttggggtgcctgtccgcacctacactcat
gaggtggtaactctatggtaccgagctccagaaattcttttgggctgcaaatactactcc
acagcggttgacatctggagtttgggctgcatctttgctgaaatgatcaccaggagggct
ttgtttccaggcgactcagagatcgatcagctgttccggatcttccgtaccctgggcaca
ccggacgaggtggcctggccaggggtcacttccatgcctgactacaagccctccttcccc
aagtgggcccgacaggagctgtccaaagtggttcccccactggacgaggatgggagagag
ctgctcaggcaaatgctgagctatgacccaaacaagaggatatctgccaaaaatgccctg
gtccatcggtttttccgtgatgtcaccatgccaatgccacacctacgactgtga

DBGET integrated database retrieval system