KEGG   Salmo salar (Atlantic salmon): 100196891
Entry
100196891         CDS       T04363                                 

Gene name
map2k4, mp2k4
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04620  Toll-like receptor signaling pathway
sasa04912  GnRH signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100196891 (map2k4)
   04012 ErbB signaling pathway
    100196891 (map2k4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100196891 (map2k4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100196891 (map2k4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100196891 (map2k4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    100196891 (map2k4)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100196891 (map2k4)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE7 family
   100196891 (map2k4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal YrbL-PhoP_reg APH
Other DBs
NCBI-GeneID: 100196891
NCBI-ProteinID: NP_001135384
UniProt: B5X2M1
LinkDB
Position
ssa06
AA seq 416 aa
MEFKHTMATPSPNNSTTSTSHNSNNAGSTGSHHHQSQSQHITTMSSMQESNTCWRCQSET
ALKLNFANPPIKPTTRFTLNTAGPPFQNPHIERLRTHSIESSGKLKTAGGDCDFTAEDLK
DLGEIGRGAYGSVNKMVHKPSNQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCLYIVQ
FYGALFREGDCWICMELMSTSFDKFYKYVYCALDDVIPEEILGKITLATVKALNHLKEYL
KIIHRDIKPSNILLDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQG
YDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGEPPQLTNSEDRQFSPKFINF
VNLCLTKDESKRPKYKELLKHAFILMYEERSVDVASYVCRILDQMPTSPSSPMYVD
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggaattcaaacacacaatggcgactcccagccccaacaactcaacaacatctaccagc
cacaacagcaataacgcaggatctacaggctcacatcaccatcaatcccagtcgcaacac
ataacaacaatgagcagtatgcaagaatccaacacgtgctggagatgtcagagtgaaaca
gcactgaagttaaattttgccaatcccccgatcaaaccaacgaccaggttcactctgaat
acagcaggacccccattccagaacccccacatagagaggctgcgtacgcatagtatcgag
tcgtcagggaagttgaagaccgccggtggcgattgtgacttcacggctgaggacctcaag
gacctgggggagattgggcggggcgcttacggctctgtcaacaagatggtgcacaagccc
agcaaccagataatggctgtcaagaggattaggtcaacggttgatgagaaggaacagaag
cagctgctaatggacctggatgtggtcatgaggagtagtgactgtctctacatagttcag
ttttacggggctcttttcagagagggagactgttggatatgtatggaacttatgtctacc
tccttcgacaaattctacaaatatgtatattgtgctttagatgatgtgattccagaggaa
atattaggcaaaataacattagctactgtgaaagcacttaaccacttaaaagaatacttg
aaaataattcacagagacatcaagccgtccaacatcctcctggacaggaatggcaacatt
aagctttgtgattttggcatcagtgggcagctggtggactccattgccaaaaccagagat
gcagggtgcagaccgtacatggcaccagagagaatagacccaagtgcctccagacaaggc
tatgacgtccggtcagacgtctggagtttggggataacactgtacgaactggcgactggg
cggtttccctacccaaagtggaacagtgtgtttgaccagttgacacaggtggtgaaggga
gaacctccacagcttaccaactcagaagacaggcagttctcccccaaattcatcaacttt
gtcaatctgtgccttacaaaggatgagtcaaaaaggccaaagtacaaagagcttctgaaa
catgctttcattctgatgtatgaggagcgctcagtggatgttgccagttatgtctgcaga
atcctggatcagatgcctacttctcccagctcccccatgtacgtcgactga

KEGG   Salmo salar (Atlantic salmon): 106564723
Entry
106564723         CDS       T04363                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 7-like
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04141  Protein processing in endoplasmic reticulum
sasa04530  Tight junction
sasa04620  Toll-like receptor signaling pathway
sasa04912  GnRH signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106564723
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106564723
   04012 ErbB signaling pathway
    106564723
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    106564723
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106564723
  09152 Endocrine system
   04912 GnRH signaling pathway
    106564723
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106564723
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106564723
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     106564723
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE7 family
   106564723
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 106564723
NCBI-ProteinID: XP_013986486
UniProt: A0A1S3L681
LinkDB
Position
ssa12
AA seq 439 aa
MSSLEQRLSRIEEKLKQENKEARRRIDLNIDMSPQRSRPRPIIVIQLSPAPAPSQRAALQ
LPLANDGGGSRSSSSESSPQHHSYPSRPRHMLNLPTPQYGLVKSLENAEIDQKLQEIMKQ
TGYLKIDGQRYPAEVSDLISEGEIGSGTCGQVFKVRFKKTGHVIAVKQMRRTGNKDENKR
ILMDLDVVLKSHDCPYIIQCYGAIVTNTDVFIAMELMGTCAEKLKKRIQGPIPERILGKM
TVAIVSALLYLKEKHGVIHRDVKPSNILLDNKGQIKLCDFGISGRLVDSKAKTRSAGCAA
YMAPERIDPPDPSKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPS
LPLSMDFSLDFQSFVKDCLTKDHRKRPKYHKLLEHSFIRRYEVLVVDVAGWFQAVMERTE
SPRSSQCYSQHQLHSLFSR
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgtcgtcgctggaacagagactctccagaatcgaggagaaactaaagcaagaaaataaa
gaagctcgtagaagaattgacctcaatatcgacatgagtccacaacgttcacgtccgagg
ccaatcatcgtgatccagctcagtcctgctccagctccttcccagcgtgcagctcttcag
ctgcccctggctaacgacggaggggggagtcgctcttcgtcctctgagagctcaccccag
caccattcctaccccagccgcccgcgacacatgctcaacctgcccacgccacagtacggc
ctggtgaagagcctggagaatgcagagatagaccagaagctgcaggagatcatgaaacag
acaggctacctaaagatcgacggccagcggtacccagccgaggtcagtgacttgatcagc
gagggggagatcggcagcggcacgtgcggtcaggtgttcaaagtgcgcttcaagaagacg
ggccacgtcatcgccgtcaaacaaatgcgccggacaggaaacaaggacgagaacaagagg
attctgatggatctggatgttgtgctgaagagccacgactgcccttacatcatccagtgc
tacggtgccatagttaccaacacggatgtgttcatcgcaatggagttgatggggacgtgt
gctgagaaactcaagaagaggatccaggggcccatccctgaacgcatcctgggcaagatg
actgtagcaatcgtatcggctctgctgtacctgaaggagaagcatggtgtgatccaccgg
gatgtgaagccctccaacattctgttggacaacaagggccagatcaagctgtgtgacttt
ggcatcagcggacgactcgtcgactccaaggccaagacccgcagcgccggctgtgctgcc
tacatggctcctgagagaatagaccccccagatcccagcaagcctgactatgacatccga
gcagacgtctggagcctgggcatctctctggtggagctggccacaggacagttcccctat
aagaactgcaagactgactttgaggtcctgaccaaagtgctgcaggaagaccctccctcg
ctccccctcagcatggacttctccctcgacttccagtccttcgtcaaagactgcctcaca
aaggatcacagaaaaaggccaaaataccacaagctgctcgagcacagtttcattcggcgc
tatgaggtgctggtggtggacgtggcgggctggttccaggcggtgatggagcgcactgag
tcgccgcgcagcagccaatgttacagccagcaccagctccactcgctgttcagcaggtag

KEGG   Salmo salar (Atlantic salmon): 106578855
Entry
106578855         CDS       T04363                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4-like
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04620  Toll-like receptor signaling pathway
sasa04912  GnRH signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106578855
   04012 ErbB signaling pathway
    106578855
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106578855
  09152 Endocrine system
   04912 GnRH signaling pathway
    106578855
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106578855
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106578855
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     106578855
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE7 family
   106578855
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal Choline_kinase APH YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 106578855
NCBI-ProteinID: XP_014013556
UniProt: A0A1S3NEJ2
LinkDB
Position
ssa19
AA seq 417 aa
MATPSSNSNSTTSSGNSNIAGSTSHHHHPQTQHMTTVSSMQESNTCWRCQNETGKRKALK
LNFANPSVKPATRLPLNPSPSTAPSFQNPHIERMRTHSIESSGKLKISTENACDFTAEDL
RDLGEIGRGAYGSVNQMQHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCLYIV
QFYGALFREGDCWICMELMSTSFDKFYKYVYCSLDDVIPEEILGKITLATVKALNHLKEN
LKIIHRDIKPSNILMDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQ
GYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGEPPQLCNSEDRQFSPKFIN
FVNLCLTKDESKRPKYKELLKHPFILMYEERFVDVASYVCRILDQIPASPISPMYLD
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcgactcccagttccaacagcaattcaacaacctccagcggaaacagcaacattgca
ggatccacctcgcaccaccatcacccgcaaacacaacacatgaccaccgtcagcagcatg
caagaaagtaacacgtgctggaggtgtcaaaacgaaacaggtaaacgtaaagccctgaag
ctgaacttcgccaacccttcagtgaagccagctaccaggttgcccctcaacccctcacct
tcaactgccccctccttccagaacccacacatagagcgtatgaggacacacagtatcgag
tcgtcggggaagctgaagatttctacggagaatgcctgtgacttcacggccgaggacctg
agggacctgggggagattggccgtggggcctatggctccgtcaaccagatgcagcacaaa
cccagcggacagatcatggctgtcaagaggatccgctccacggtggatgagaaggagcag
aagcagctgctgatggatctagacgtggtgatgaggagtagtgactgtctctacatcgtt
cagttctacggagctctcttcagagagggcgactgttggatatgtatggaactaatgtct
acctcattcgacaaattctacaaatatgtatattgttcgttagatgacgtcattccagag
gaaatattaggcaaaattacattagcaaccgttaaagcgctgaaccacttaaaagaaaac
ttgaaaataattcacagagacatcaaaccttccaacattctcatggaccgtaacggcaac
atcaaactgtgtgactttggcatcagtggtcagctggtggactctatagccaagaccaga
gacgcaggctgcagaccctacatggcaccggagaggatagaccccagtgcttccagacaa
ggctacgacgtccgatctgacgtgtggagtttggggatcaccctgtatgagttggccacc
ggcagattcccgtaccccaagtggaatagcgtgtttgatcagctgacccaggtggtgaag
ggcgagccaccgcagctctgcaactctgaggacagacagttctcccccaagttcatcaac
tttgtcaatttatgcctcacaaaggatgagtcaaaacggcccaagtacaaggagctcttg
aaacacccgttcatcttgatgtacgaggagaggtttgtggacgtggccagctacgtgtgt
cgcatcctggaccagatcccagcgtcccccatctcacccatgtacctggactga

KEGG   Salmo salar (Atlantic salmon): 106587435
Entry
106587435         CDS       T04363                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 7-like
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04141  Protein processing in endoplasmic reticulum
sasa04530  Tight junction
sasa04620  Toll-like receptor signaling pathway
sasa04912  GnRH signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106587435
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106587435
   04012 ErbB signaling pathway
    106587435
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    106587435
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106587435
  09152 Endocrine system
   04912 GnRH signaling pathway
    106587435
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106587435
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106587435
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     106587435
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE7 family
   106587435
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 106587435
NCBI-ProteinID: XP_014031308
UniProt: A0A1S3PUE0
LinkDB
Position
ssa02
AA seq 439 aa
MSSLEQRLSRIEEKLKQENKEARRRIDLNIDMSPQRSRPRPIIVIQLSPAPAPSQRAALQ
LPLANDGGGSRSSSSESSPQHHSYPSRPRHMLNLPTPQYSLVKSVENAEIDQKLQEIMKQ
TGYLKIDGQRYPAEVSDLISEGEIGSGTCGQVFKVRFKKTGHVIAVKQMRRTGNKDENKR
ILMDLDVVLKSHDCPYIIQCYGAIVTNTDVFIAMELMGTCAEKLKKRIQGPIPERILGKM
TVAIVSALLYLKEKHGVIHRDVKPSNILLDNKGQIKLCDFGISGRLVDSKAKTRSAGCAA
YMAPERIDPPDPSKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEDPPS
LPLSMDFSLDFQSFVKDCLTKDHRKRPKYHKLLEHSFIRRYEVLVVDVAGWFQAVMERTE
SPRSSQCYSQHQLHSLFSR
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgtcgtcgctggaacagagactctcccgaatcgaggagaaactaaagcaagaaaataaa
gaagctcgtagaagaattgacctcaatatcgacatgagtccacaacggtcacgtccgagg
ccaatcatcgtgatccagctcagtcctgctccagctccttcccaacgtgcagctcttcag
cttcccctggctaacgacggaggggggagtcgctcctcgtcttctgagagctcaccccag
caccattcctaccccagccgcccgcgacacatgctcaacttgcccacgccacagtacagc
ctggtgaaaagcgtggagaatgcggagatagaccagaagctgcaggagatcatgaaacag
acaggctacctgaagatcgacggccagcggtacccggctgaggtcagtgacctgatcagc
gagggggagatcggcagcggcacgtgcggtcaggtgttcaaagtgcgcttcaagaagacg
ggccacgtcatcgccgtcaaacaaatgcgccggacaggaaacaaggacgagaacaagagg
attctgatggatctggatgtggttctgaagagccacgactgcccttacatcatccagtgc
tacggcgccatagttaccaacacggatgtgttcatcgcaatggagctgatggggacgtgt
gctgagaaactcaagaagaggatccaggggcccatccctgaacgcatcctgggcaagatg
accgtggcaatcgtgtcggctctgctgtacctgaaggagaagcacggtgtgatccaccgg
gacgtgaagccctccaacatcctgctggacaacaagggccagatcaagctgtgtgacttt
ggcatcagtggacgactcgtcgactccaaggccaagacccgcagcgccggctgtgctgcc
tacatggctcctgagagaatagaccccccagatcccagcaagcctgactatgacatccga
gcagacgtctggagcctgggcatctctctggtggagctggccacaggacagttcccctat
aagaactgcaagaccgactttgaggtcctgaccaaagtgctgcaggaagaccctccctcg
ctccccctcagcatggacttctccctcgacttccagtccttcgtcaaagactgcctcaca
aaggatcacagaaaaaggccaaaataccacaagctgctcgagcacagtttcattcggcgc
tatgaggtgctggtggtggacgtggcgggctggttccaggcggtgatggagcgcactgag
tctccgcgcagcagccaatgttacagccagcaccagctccactcgctcttcagcaggtag

KEGG   Salmo salar (Atlantic salmon): 106589490
Entry
106589490         CDS       T04363                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4-like
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04620  Toll-like receptor signaling pathway
sasa04912  GnRH signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106589490
   04012 ErbB signaling pathway
    106589490
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106589490
  09152 Endocrine system
   04912 GnRH signaling pathway
    106589490
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106589490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106589490
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     106589490
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE7 family
   106589490
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal Choline_kinase YrbL-PhoP_reg APH
Other DBs
NCBI-GeneID: 106589490
NCBI-ProteinID: XP_014035021
UniProt: A0A1S3Q521
LinkDB
Position
ssa28
AA seq 426 aa
MASPSSNSNSTTSNSNIAGSTSHHHHPQTQHMTTVSNMQEINTCWRCQNETGFQISLSGV
PQSKRKALKLNFANPPVKPATRLPLNPSPSTAPSFQNPHIERMRTHSIESSGKLKISTEN
ACDFTAEDLRDLGEIGRGAYGSVNKMQHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVM
RSSDCLYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYCSLDDVIPEEILGKITLATV
KALNHLKENLKIIHRDIKPSNILMDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPE
RIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGEPPQLCNSED
RQFSPKFINFVNLCLTKDESKRPKYKELLKHPFILMYEERCVDVASYVCRILDQIPASPI
SPMYLD
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggcgtctcccagttccaacagcaactcaacaacctccaacagcaacatcgcaggatcc
acctcgcaccaccatcacccgcaaacacaacacatgaccaccgtcagcaacatgcaagaa
atcaacacgtgctggaggtgtcaaaacgaaacagggtttcagataagcctgtctggagtg
ccccaaagtaaacgtaaagccctgaagctgaacttcgccaaccctccagtgaagccagct
accaggttgcccctcaatccctcaccttcaaccgccccctccttccagaacccacacata
gagcgtatgaggacacacagtatcgagtcgtcggggaagctgaagatttccacagagaat
gcctgtgacttcacggccgaggacctgagggacctgggggagatcggccgtggggcatac
ggctccgtcaacaagatgcagcacaaacccagcggacagatcatggccgtcaagaggatc
cgttccacggtggatgagaaggagcagaagcagctgctgatggatctagacgtggtgatg
aggagtagtgactgtctctatatcgtccagttttacggagctctcttcagagagggtgac
tgttggatatgtatggaactaatgtctacctcattcgacaaattctacaaatatgtatat
tgttcgttagatgacgtcattccagaggaaatattaggcaaaatcacattagcaaccgtt
aaagcactgaaccacttaaaagaaaacttgaaaataattcacagagacatcaaaccttcc
aacattctcatggatcgtaacggcaacatcaagttgtgtgactttggcatcagcggtcag
ctggtggactcaatagccaagaccagagacgcaggctgcagaccctacatggcgccggag
aggatagaccccagtgcttccagacaaggctacgacgtccgatcagacgtgtggagtttg
gggataaccctgtatgagcttgccaccggtaggttcccctaccccaagtggaatagtgtg
tttgatcagctgacccaggtggtgaagggcgagccgccccagctctgcaactctgaagac
aggcagttctcccccaagttcatcaactttgtcaacttatgccttacaaaggatgagtca
aaacggccaaagtacaaggagctcctgaaacacccgttcatcctgatgtacgaggagagg
tgtgtggatgtggccagctacgtgtgtcgcatcctggaccagatcccagcgtcccccatc
tcacccatgtacctggactga

KEGG   Salmo salar (Atlantic salmon): 106601504
Entry
106601504         CDS       T04363                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4-like
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04620  Toll-like receptor signaling pathway
sasa04912  GnRH signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106601504
   04012 ErbB signaling pathway
    106601504
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106601504
  09152 Endocrine system
   04912 GnRH signaling pathway
    106601504
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106601504
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106601504
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     106601504
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE7 family
   106601504
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal YrbL-PhoP_reg APH
Other DBs
NCBI-GeneID: 106601504
NCBI-ProteinID: XP_014049206
UniProt: A0A1S3RAQ4
LinkDB
Position
ssa03
AA seq 421 aa
MATPSPNNSTSTSNNAGSTGSHHHQSQSQHITTMSSMQESNTCWRCQSETGFQINLSGAP
PSKRKALKLNFANPPIKPTTRFTLNTAGPPFQNPHIERLRTHSIESSGKLKTAGGDCDFT
AEDLKDLGEIGRGAYGSVNKMVHKPSNQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDC
LYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYCALDDVIPEEILGKITLATVKALNH
LKEYLKIIHRDIKPSNILLDRNGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPS
ASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGEPPQLTNSEDRQFSP
KFINFVNLCLTKDESKRPKYKELLKHAFILMYEERSVDVASYVCRILDQMPTSPSSPMYV
D
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggcgactcccagccccaacaactcaacatctaccagcaataacgcaggatctacaggc
tcccatcaccatcaatcccagtcgcaacacataacaacaatgagcagtatgcaagaatcc
aacacgtgctggagatgtcagagtgaaacagggtttcagataaacctgtctggagctccc
ccaagtaaacgcaaagcactgaagttaaattttgccaatcccccgattaaaccaacgacc
agattcactctgaatacagcaggacccccattccagaacccccacatagagaggctgcgt
acgcatagtatcgagtcatcagggaagttgaagaccgccggtggcgattgtgacttcacg
gctgaggacctcaaggacctgggggagattgggcggggcgcgtacggctctgtcaacaag
atggtgcacaaacccagcaaccagataatggctgtcaagaggattaggtcaacggttgat
gagaaggaacagaagcagctgctaatggacctggatgtggtcatgaggagtagtgactgt
ctctacatagttcagttttacggggctcttttcagagagggagactgttggatatgtatg
gaactaatgtctacctccttcgacaaattctacaaatatgtatattgtgctttagatgat
gtgattccagaggaaatattaggcaaaataacattagctactgtgaaagcacttaaccac
ttaaaagaatacttgaaaataattcacagagacatcaagccatccaacatcctcctggac
aggaatggcaacattaagctttgtgattttggcatcagtgggcagctggtggactccatt
gccaaaaccagagatgcagggtgcagaccgtacatggcacctgagagaatagacccaagt
gcctccagacaaggctatgacgtccggtcagacgtatggagtttggggataacactgtac
gagctggcgactgggcggtttccctacccaaagtggaacagtgtgtttgaccagttgaca
caggtggtgaagggagaacctccacagcttaccaactcagaagacaggcagttctccccc
aaattcatcaactttgtcaatctgtgccttacaaaggatgagtcaaaaaggccaaagtac
aaagagcttctgaaacatgctttcattctgatgtatgaggagcgctcagtggatgttgcc
agttacgtctgcagaatcctggatcagatgcctacttctcccagctcccccatgtacgtc
gactga

DBGET integrated database retrieval system