KEGG   Salmo salar (Atlantic salmon): 100286458
Entry
100286458         CDS       T04363                                 

Gene name
ereg
Definition
(RefSeq) Proepiregulin
  KO
K09784  epiregulin
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100286458 (ereg)
   04012 ErbB signaling pathway
    100286458 (ereg)
SSDB
Motif
Pfam: EGF EGF_2
Other DBs
NCBI-GeneID: 100286458
NCBI-ProteinID: NP_001139869
UniProt: B9ELM3
LinkDB
Position
ssa24
AA seq 184 aa
MTHLKAAHPLCDGLSPSLTAKTAMRNPQPAILLSFLALLLVWPDVHSTDVLSSTQPAPTS
PASSHCEAETTADQEQSRPHMEKVMSQKCDSSVESYCLNGECLLLLDLNEHHCKCERGYY
GPRCAHLEMVFQPMKEEHVILMVVCGGLLFIGVVGAFYFFCRWYKRNRCPPQQKQQTYQE
VQMA
NT seq 555 nt   +upstreamnt  +downstreamnt
atgacccacttaaaagcggcccatcctctctgcgacggtctctctccatctctgaccgct
aaaacagcaatgaggaacccacaaccggccatcctgctctcatttctcgctctgttattg
gtctggcctgatgtacattctacagatgtcctctcctccacacagccagccccaaccagc
cctgcttcctcccactgtgaggcagaaacaacagcagaccaggagcagtcccgtcctcac
atggagaaggtgatgagccagaaatgtgactccagtgtggagagctactgtctcaacgga
gaatgtctcctattgttggatctcaacgaacaccactgcaagtgtgagaggggttactac
gggcccaggtgtgctcacctggagatggtgtttcagccaatgaaagaagagcatgtcatc
ctgatggtggtatgtggggggcttctgtttataggcgtcgttggagctttctacttcttc
tgccgatggtacaagagaaatagatgtccaccgcaacagaaacagcagacgtaccaggag
gtgcagatggcgtga

DBGET integrated database retrieval system