KEGG   Salmo salar (Atlantic salmon): 100286677
Entry
100286677         CDS       T04363                                 

Gene name
cdk6
Definition
(RefSeq) cyclin dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100286677 (cdk6)
   04115 p53 signaling pathway
    100286677 (cdk6)
   04218 Cellular senescence
    100286677 (cdk6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    100286677 (cdk6)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100286677 (cdk6)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100286677 (cdk6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo RIO1 FTA2
Other DBs
NCBI-GeneID: 100286677
NCBI-ProteinID: NP_001140089
UniProt: B9EQ22
LinkDB
Position
ssa14
AA seq 324 aa
MDNESVAHRYEPVAEIGEGAYGKVYKARDLNNAGRFVALKRVRVQTEEEGMPLSTIREVA
VLRQLEAFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLEKAPDPGVPPETIK
DMMYQLLQGLDFLHSHRVVHRDLKPQNILVTSGGQIKLADFGLARIYSFQMALTSVVVTL
WYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRRPLFRGSSDVDQLGKIFDVVGVPSVEDW
PQEVALPQSAFSPRPPQPIGNLIPDMDELGKSLILQFLAFNPAKRISAFAALTHPYFQSV
DSDSKSVYAQPIASNKPTMEESAA
NT seq 975 nt   +upstreamnt  +downstreamnt
atggacaatgaaagtgtagcacacagatacgagcccgtcgccgagattggcgaaggtgct
tacggaaaggtgtacaaggcacgagatttgaacaacgcgggacgctttgtagccctaaaa
agagttcgggtacagacggaggaggaagggatgcccctctcgaccatccgtgaggtggcg
gtactgaggcaactggaggcatttgaacaccccaacgtggtcagactgttcgatgtgtgt
actgtgtctcggaccgaccgcgagaccaagctgaccctggtctttgagcatgttgaccag
gacctgaccacatacctagagaaagcccctgatcctggggtgccacctgaaacaatcaag
gatatgatgtaccagctgctgcaggggttggacttcctgcactcacaccgtgtggttcac
cgggacctgaaaccccagaacatcctggtcaccagcggaggacagataaaactggccgac
ttcggtcttgccagaatatacagctttcagatggccctgacctccgtggtggtgacgttg
tggtacagagccccagaggtgttgctccagtccagctatgccaccccagttgacttgtgg
agtgtgggctgtatcttcgctgagatgttcaggagaagacctttgtttagaggaagctca
gatgttgatcagctgggcaagatttttgatgtggtcggggttccctcggtggaggactgg
ccccaggaagttgccttaccacagagtgccttctctccacgaccccctcagcctatcgga
aacctcatccctgacatggacgagctggggaagtccctaatactgcaattcctggcattc
aatcccgccaaaaggatatcagcgtttgctgctctgacccacccctacttccagagtgtg
gatagtgacagtaagagtgtgtacgctcagcccattgccagcaacaagcccaccatggag
gagagcgctgcctga

KEGG   Salmo salar (Atlantic salmon): 106565448
Entry
106565448         CDS       T04363                                 

Definition
(RefSeq) cyclin-dependent kinase 4-like
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106565448
   04115 p53 signaling pathway
    106565448
   04218 Cellular senescence
    106565448
  09144 Cellular community - eukaryotes
   04530 Tight junction
    106565448
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106565448
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     106565448
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   106565448
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 106565448
NCBI-ProteinID: XP_013988069
UniProt: A0A1S3LB53
LinkDB
Position
ssa12
AA seq 305 aa
MAQGSGVQYEPVAEIGGGAYGTVYKARDLESGQFVALKSVRVQTDQDGLPISTVREVALL
KRLEQFDHPNVVKLMDVCATLRTDQETKVTLVFEHVDQDLKTYLEKAPAPGLPPSHIRDL
MRQLLCGLSFLHSNRVVHRDLKPENILVTSRGQVKLADFGLARIYSCHMALTPVVVTLWY
RPPEVLLQSTYATPVDIWSTGCIFAEMFRRKPLFSGDSEMDQLGKIFNVIGLPPMEEWPA
DVTLSRHNFSPISPRPITDYVPEINEQGAELLLKMLTFDPLRRISALNAQEHPYFQEDEE
EVTNG
NT seq 918 nt   +upstreamnt  +downstreamnt
atggcccagggcagtggggtccagtacgagccagtggcagagattggagggggtgcgtac
ggaacggtgtacaaggctcgggacctggagagcggccagtttgttgctctgaagagtgtt
cgcgtccagacggaccaagatggcctccctatctccacggtccgagaagtggccctgctg
aagagactggagcagtttgatcatcccaacgtggtcaagctcatggacgtgtgtgccacc
ctgaggacagatcaggagactaaagtcaccctggtatttgaacacgtggaccaggacctg
aagacctacctagagaaggcccccgcaccaggactgccccccagccacatcagagacctg
atgcgtcaattgctgtgcggcctgtcattcctacactcgaaccgtgtggtgcaccgggac
ctgaagccagagaacatcctggtcaccagccgtggtcaggtgaagctggccgactttgga
ctggccaggatctacagttgccacatggcccttacccctgtggtggtgactctgtggtac
aggcctcctgaggtcctgctccagtccacctacgccacgccggtggacatctggagcacg
ggctgcatctttgctgagatgttccgacgcaaaccgttgttctctggagactctgaaatg
gaccaactgggaaagatattcaatgtgattggcctgccacccatggaggagtggcctgct
gatgtcaccctctcacgacacaacttcagtcctatcagcccccgcccaatcacagactac
gttcctgagatcaatgagcagggggcagagctgcttttgaaaatgctaacctttgaccct
ctaagaagaatctctgccctaaacgctcaagaacatccttacttccaggaggatgaggag
gaagtgacaaatggttga

KEGG   Salmo salar (Atlantic salmon): 106583286
Entry
106583286         CDS       T04363                                 

Definition
(RefSeq) cyclin-dependent kinase 4-like
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106583286
   04115 p53 signaling pathway
    106583286
   04218 Cellular senescence
    106583286
  09144 Cellular community - eukaryotes
   04530 Tight junction
    106583286
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106583286
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     106583286
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   106583286
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1
Other DBs
NCBI-GeneID: 106583286
NCBI-ProteinID: XP_014022738
UniProt: A0A1S3P556
LinkDB
Position
ssa22
AA seq 311 aa
MFLVQAMAQGSEVQYEPVAEIGGGAYGTVYKARDLESGQFVALKSVRVQTDQDGLPISTV
REVALLKRLEQFDHPNVVKLMDVCATLRTDQETKVTLVFEHVDQDLKTYLEKAPAPGLPP
SRIQDLMRQLLCGLAFLHSNRVVHRDLKPENILVTSRGQVKLADFGLARIYSYHMALTPV
VVTLWYRPPEVLLQSTYATPVDIWSTGCIFAEMFRRKPLFCGDSEVDQLGKIFNVIGLPP
EEEWPADVTLSRHNFSPISPRPITDYAPEINKQGTELLLKMLTFDPLRRISALNALEHPY
FQENEEEVTNG
NT seq 936 nt   +upstreamnt  +downstreamnt
atgtttctagtccaggccatggcccagggcagtgaggtccagtacgagccggtggcagag
atcggaggtggtgcgtacgggacggtgtacaaagctcgggacctggagagcgggcagttt
gtagctctgaagagcgttcgcgtccagacggaccaagatggcctccccatctccacagtc
agagaggtggccctgctgaagagactggagcagtttgaccatcccaacgtggtcaagctc
atggacgtatgtgccaccctgaggacggatcaggagactaaagtcaccctggtgtttgag
cacgtggaccaggaccttaagacctacctagagaaggcccctgccccaggactgcccccc
agccgcatccaagacctgatgcgtcagttgctgtgtggcctggcgttcctccactcgaac
cgcgtggtgcaccgggacctgaagccagagaacatcctggtcaccagccgtggtcaggtg
aagctggccgactttggactggcaaggatctacagctaccacatggccctcactcctgtg
gtggtgactctgtggtacaggcctcctgaggtcttgctccagtccacctatgccacgcct
gtggacatctggagcacgggctgcatctttgctgagatgttccgacgcaaaccattgttc
tgtggagactctgaagtggaccaactgggaaagatattcaatgtgattggcctgccacct
gaggaggagtggcctgctgatgtcaccctctcacgacacaacttcagtcctatcagcccc
cgcccaatcaccgactacgctccagagatcaataaacaggggacagagttgctgctgaaa
atgctaacttttgaccctctaagaagaatctctgccctgaatgctctagaacatccttac
ttccaggagaatgaggaggaagtgacaaatggttga

KEGG   Salmo salar (Atlantic salmon): 106588946
Entry
106588946         CDS       T04363                                 

Definition
(RefSeq) cyclin-dependent kinase 6-like
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106588946
   04115 p53 signaling pathway
    106588946
   04218 Cellular senescence
    106588946
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106588946
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     106588946
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   106588946
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo RIO1 FTA2
Other DBs
NCBI-GeneID: 106588946
NCBI-ProteinID: XP_014033999
UniProt: A0A1S3Q219
LinkDB
Position
ssa27
AA seq 324 aa
MDKESVAQQYEPVAEIGEGAYGKVYKARDLKNEGRFVALKRVRVQTEEEGMPLSTIREVA
VLRQLEAFEHPNVVRLFDVCTVSRSDRETKLTLVFEHVDQDLTTYLEKAPDPGVPPETIK
DMMYQLLQGLDFLHSHRVVHRDLKPQNILVTSGGQIKLADFGLARIYSFQMALTSVVVTL
WYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRRPLFRGNSDVDQLGKILDVVGVPSVEDW
PQEVALPQSAFSPRPPQPIGELVPDMDELGKSLLLQFLAFNPSRRISAFAALTHPYFQSV
DSDTKSVYAQPIGSNKPTLEERAA
NT seq 975 nt   +upstreamnt  +downstreamnt
atggacaaagaaagtgtagcacaacagtacgagcccgtcgccgagattggggaaggtgcg
tatggaaaggtgtacaaggcacgagatttgaagaacgagggacgctttgtagccctaaaa
cgagttcgggtgcagacggaggaggaagggatgcccctctcgaccatccgtgaggtggcg
gtactgaggcaactggaggcattcgaacaccccaacgtggtcagactgtttgatgtgtgt
actgtgtctcggagcgaccgcgagaccaagctgaccctggtctttgagcacgttgaccag
gacttgaccacgtacctggaaaaagcccctgatcctggggtgccacctgaaactatcaaa
gatatgatgtaccagctgctgcagggactggacttcctgcactcacaccgtgtggttcac
cgggacctgaaaccccagaacattttggtcaccagtggaggacagatcaaactggctgat
tttggcctcgccaggatatacagctttcagatggccctgacctctgtggtggtgacattg
tggtacagagccccagaggtgttgctccagtccagctatgccaccccagttgacctgtgg
agtgtgggctgtatcttcgctgagatgttcaggaggagacctttgtttcgaggaaactca
gatgttgatcagctgggcaagattttagatgtggtcggggttccctcggtggaggactgg
ccccaggaagtagccctaccacagagtgccttctccccacgaccccctcagccaatcgga
gaacttgtccctgacatggacgagcttgggaaatcccttttactccaattcctggctttt
aatccctccagaaggatatcagcgtttgctgctctgacccacccctacttccagagtgtg
gatagtgacactaagagtgtgtacgcccagcccatcggcagcaacaagcccaccctggag
gagagagctgcctga

KEGG   Salmo salar (Atlantic salmon): 106600958
Entry
106600958         CDS       T04363                                 

Definition
(RefSeq) cyclin-dependent kinase 6-like
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106600958
   04115 p53 signaling pathway
    106600958
   04218 Cellular senescence
    106600958
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106600958
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     106600958
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   106600958
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like RIO1
Other DBs
NCBI-GeneID: 106600958
NCBI-ProteinID: XP_014048240
UniProt: A0A1S3R7A5
LinkDB
Position
ssa03
AA seq 301 aa
MEGNGCDEHRNYEILAEIGEGAYGKVYKAREVRDQQRLVAVKKLNIPGHTESGIPAFMIR
EVALLRKIGYFNHPNIVKLLDVSAGLKNRSLDLMLVFEYIDQDLSTFLTTVPSTGLSLDK
IKDVMVQLLQGLDFLHTNMLVHRDLKPENVLVSSRGEVKIADFGLARIYTYHIALTPCVV
TLWYRAPEVLLHSGYMSSVDMWSAGCIFAELFLLRPLFRGYTEAQQLQKIFEVIGLPSEE
DWPRESPISYSRSWCPRDPCTQLLSNLGQEENNLLLQCLEFSPTNRISASRALSHPFLVC
A
NT seq 906 nt   +upstreamnt  +downstreamnt
atggagggcaatgggtgcgatgaacatcggaattatgaaatacttgcagagataggcgaa
ggcgcatatggcaaagtgtacaaggccagagaggtccgcgatcaacagcgactcgtagcg
gtgaagaagttgaacatacccggacacacggagagtgggatccctgctttcatgatccga
gaggtggcgctcttgcgtaagatcgggtatttcaaccatcccaacattgtaaagttgttg
gatgtatctgctggtctgaagaacaggagtttggacctgatgctggtgtttgagtacatc
gaccaagacctgtctaccttcctcaccacggtccccagcactggactgagtcttgacaaa
attaaggatgtgatggtgcagctgctgcaagggctggacttcctgcacaccaacatgctg
gtgcaccgcgacctgaagccggagaatgtactggttagtagccgtggagaggtgaagatc
gctgactttgggctggcgcgcatctacacctatcacatcgcccttacaccctgtgtggtg
acactgtggtacagggcccccgaggtgctgctccactctggttacatgtcctccgtggac
atgtggagcgctggctgcatttttgccgaactattccttttgagaccgttgttccgtgga
tacactgaggctcagcagctccagaaaatctttgaggtgattggcttgcccagcgaggag
gactggcccagggagagccccatctcatactctcgtagctggtgccccagagacccctgc
acacagctcttatccaacctgggccaggaggagaacaacctactccttcaatgtctagag
ttcagcccgaccaatcgcatctcagcttccagagccctctcccaccctttcctggtgtgc
gcctga

DBGET integrated database retrieval system