KEGG   Salmo salar (Atlantic salmon): 100306767
Entry
100306767         CDS       T04363                                 

Gene name
grb2
Definition
(RefSeq) growth factor receptor-bound protein 2
  KO
K04364  growth factor receptor-bound protein 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04150  mTOR signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100306767 (grb2)
   04012 ErbB signaling pathway
    100306767 (grb2)
   04068 FoxO signaling pathway
    100306767 (grb2)
   04150 mTOR signaling pathway
    100306767 (grb2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100306767 (grb2)
   04540 Gap junction
    100306767 (grb2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100306767 (grb2)
   04912 GnRH signaling pathway
    100306767 (grb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    100306767 (grb2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    100306767 (grb2)
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    100306767 (grb2)
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   100306767 (grb2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH2 SH3_2 SH3_10 SH3_3 SH2_2 SH3_4 DUF5093 hSH3
Other DBs
NCBI-GeneID: 100306767
NCBI-ProteinID: NP_001158778
UniProt: C0H8R6
LinkDB
Position
ssa03
AA seq 217 aa
MEAIAKYDFKATADDELSFKRGEVLKVLNEECDQNWYKAELNGKDGFIPKNYIEMKAHPW
FFGKIPRAKAEEMLNKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVTQHPTYVQALFDFDPQEDGELGFRRG
DFIQVLDNSDPNWWKGGCHGLTGMFPRNYVTPVNRNM
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaggccattgccaaatacgatttcaaagccactgctgacgacgagttaagttttaaa
cgtggggaagttctaaaggtattaaatgaagagtgtgaccagaactggtacaaagcagaa
ttgaacgggaaagacggcttcatccccaagaactacatagagatgaaagcacatccgtgg
ttctttggcaagatcccccgtgccaaggcagaggagatgttgaacaaacagaggcacgac
ggggccttcctcatccgagagagtgagagtgcgccaggggacttctccctctctgtcaag
tttggaaatgacgttcagcacttcaaagtcctgcgtgatggggcaggaaagtacttcctg
tgggtggtgaagttcaactcgctcaacgagctggtggactaccaccgctccacctctgta
tcccgcaaccaacagatcttcctgcgtgacattgagcaggtcacccagcatcccacatat
gtacaggcgctctttgactttgacccccaggaggatggcgagctgggattccgacgcgga
gacttcatccaggtcctggacaactctgaccctaactggtggaagggaggatgccacggg
ctgacgggcatgttcccccgcaactatgtcacaccagtcaaccggaacatgtaa

KEGG   Salmo salar (Atlantic salmon): 106564671
Entry
106564671         CDS       T04363                                 

Definition
(RefSeq) growth factor receptor-bound protein 2-like
  KO
K04364  growth factor receptor-bound protein 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04150  mTOR signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106564671
   04012 ErbB signaling pathway
    106564671
   04068 FoxO signaling pathway
    106564671
   04150 mTOR signaling pathway
    106564671
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106564671
   04540 Gap junction
    106564671
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106564671
   04912 GnRH signaling pathway
    106564671
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106564671
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    106564671
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    106564671
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   106564671
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_10 SH3_3 hSH3 SH2_2 SH3_4 DUF5093
Other DBs
NCBI-GeneID: 106564671
NCBI-ProteinID: XP_013986362
UniProt: A0A1S3PTP3
LinkDB
Position
ssa12
AA seq 217 aa
MEAIAKYDFKATADDELSFKRGETLKVLNEECDQNWYKAELNGKEGFIPKNYIEMKGHPW
FYGKIPRAKAEEMLNKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNSLVDYHRSTSVSRNQPIFLRDIEQVPQHSTYVQALFDFDPQEDGELGFRRG
DFIQVLDNSDPNWWKGACHGQTGMFPRNYVTPVNQNM
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaggccattgccaaatacgatttcaaagcaactgcggatgatgagttgagttttaaa
cgtggagagacgttgaaggttttgaatgaagaatgcgaccagaactggtacaaggcagag
ctgaatgggaaggaaggcttcatccccaagaactacatagaaatgaagggacacccgtgg
ttctatggtaagatcccccgggcaaaggcagaggagatgctgaacaaacagaggcacgat
ggggccttcctcatccgagagtcggagagcgcaccgggagacttctccctctctgtcaag
tttggtaatgacgtgcagcacttcaaggtcctgcgtgacggggctgggaagtacttcctg
tgggtggtcaagttcaactctctcaactccctggtggactaccaccgttccacctctgtg
tcccgcaaccagcccatcttcctcagggacatcgagcaggtcccacagcattcaacgtac
gtgcaggcgctgtttgacttcgaccctcaggaggacggcgagctgggcttccgacgcggc
gacttcatccaggtcctggacaactccgaccccaactggtggaaaggggcttgccacggc
cagacaggcatgttcccgcgcaactacgtcacgccagtcaaccaaaacatgtga

KEGG   Salmo salar (Atlantic salmon): 106587111
Entry
106587111         CDS       T04363                                 

Definition
(RefSeq) growth factor receptor-bound protein 2-like
  KO
K04364  growth factor receptor-bound protein 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04150  mTOR signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106587111
   04012 ErbB signaling pathway
    106587111
   04068 FoxO signaling pathway
    106587111
   04150 mTOR signaling pathway
    106587111
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106587111
   04540 Gap junction
    106587111
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106587111
   04912 GnRH signaling pathway
    106587111
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106587111
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    106587111
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    106587111
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   106587111
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_10 SH3_3 hSH3 SH2_2 SH3_4 DUF5093
Other DBs
NCBI-GeneID: 106587111
NCBI-ProteinID: XP_014030589
UniProt: A0A1S3PTP3
LinkDB
Position
ssa02
AA seq 217 aa
MEAIAKYDFKATADDELSFKRGETLKVLNEECDQNWYKAELNGKEGFIPKNYIEMKGHPW
FYGKIPRAKAEEMLNKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNSLVDYHRSTSVSRNQPIFLRDIEQVPQHSTYVQALFDFDPQEDGELGFRRG
DFIQVLDNSDPNWWKGACHGQTGMFPRNYVTPVNQNM
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaggccattgccaaatacgatttcaaagccactgcagatgatgagttgagttttaaa
cgtggagagacgttgaaggttttgaatgaagaatgcgaccagaactggtacaaggcagag
ctgaatgggaaggaaggcttcatccccaagaactacatagaaatgaagggacacccgtgg
ttctatggtaagatcccccgggcgaaggcagaggagatgctgaacaaacagaggcacgat
ggggccttcctcatccgagagtcggagagcgcaccgggagacttctccctctctgtcaag
tttggtaatgacgtgcagcacttcaaggtcctgcgtgacggggctgggaagtacttcctg
tgggttgtcaagttcaactctctcaactccctggtggactaccaccgttccacctctgtg
tcccgcaaccagcccatcttcctcagggacatcgagcaggtcccacagcattcaacgtac
gtgcaggcgctgtttgacttcgaccctcaggaggacggcgagctgggcttccgacgcggc
gacttcatccaggtcctggacaactccgaccccaactggtggaaaggcgcttgccacggc
cagacgggcatgttcccgcgcaactacgtcacgccagtcaaccaaaacatgtga

KEGG   Salmo salar (Atlantic salmon): 106607067
Entry
106607067         CDS       T04363                                 

Definition
(RefSeq) growth factor receptor-bound protein 2
  KO
K04364  growth factor receptor-bound protein 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04150  mTOR signaling pathway
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106607067
   04012 ErbB signaling pathway
    106607067
   04068 FoxO signaling pathway
    106607067
   04150 mTOR signaling pathway
    106607067
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106607067
   04540 Gap junction
    106607067
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106607067
   04912 GnRH signaling pathway
    106607067
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106607067
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    106607067
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    106607067
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   106607067
SSDB
Motif
Pfam: SH3_1 SH3_9 SH2 SH3_2 SH3_10 SH3_3 SH2_2 SH3_4 DUF5093 hSH3
Other DBs
NCBI-GeneID: 106607067
NCBI-ProteinID: XP_014059118
UniProt: C0H8R6
LinkDB
Position
ssa06
AA seq 217 aa
MEAIAKYDFKATADDELSFKRGEVLKVLNEECDQNWYKAELNGKDGFIPKNYIEMKAHPW
FFGKIPRAKAEEMLNKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVTQHPTYVQALFDFDPQEDGELGFRRG
DFIQVLDNSDPNWWKGGCHGLTGMFPRNYVTPVNRNM
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaggcaattgccaaatacgatttcaaagccactgctgacgacgagttaagttttaaa
cgtggggaagttctaaaggtattaaatgaagagtgtgaccagaactggtacaaagcagaa
ttgaacgggaaagacggcttcatccccaagaactacatagagatgaaagcacatccgtgg
ttctttggcaagatcccccgtgccaaggcagaggagatgttgaacaaacagaggcacgac
ggggccttcctcatccgagagagtgagagtgcgccaggggacttctccctctctgtcaag
tttggaaatgacgttcagcacttcaaagtcctgcgtgatggggcaggaaagtacttcctg
tgggtggtgaagttcaactcgcttaacgagctggtggactaccaccgctccacctctgta
tcccgcaaccagcagatcttcctgcgtgacattgagcaggtcacccagcatcccacatat
gtacaggcgctctttgactttgacccccaggaggatggcgagctgggcttccgacgcgga
gacttcatccaggtcctggacaactctgaccctaactggtggaagggaggatgccacggg
ctgacgggcatgttcccccgcaactacgtcacaccagtcaaccggaacatgtaa

DBGET integrated database retrieval system