KEGG   Salmo salar (Atlantic salmon): 100306816Help
Entry
100306816         CDS       T04363                                 

Gene name
ncoa4
Definition
(RefSeq) nuclear receptor coactivator 4
  KO
K09289  nuclear receptor coactivator 4
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100306816 (ncoa4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ARA70
Motif
Other DBs
NCBI-GeneID: 100306816
NCBI-ProteinID: NP_001158827
UniProt: C0H940
LinkDB All DBs
Position
ssa01
AA seq 616 aa AA seqDB search
MFTVEEREKATLRQCVQARCQLEDAIGGVTRAEVQLQDNSREVKSQLHTCISRHLESMRS
REVWLLEQIDLVQQLKGEALQAQLHQLHLLRGQFDILIHQLENSNSNDLANQLTGCMEKL
SSLNLTPEETPEMSFQADTRSLRQAITSFGTIATQHVEGGPVLNIASQSSNASERQWLQE
GCPIAAKKQRVESAPLADWLLGNRPETTAPVGYQSSKNPQDWLITRRDVQSSCPMAPFDF
HKAWGQLNNLEMWLQKKTPIRERTSCSSSSTFSIEKIDESELDMALEEEVGQEEEEQEWA
KTDDLSDWLITPATVAKETTSKSCQASEPDRWKQIFKPFQEGFSSSEWLLKSDCGSCCAT
HTKPVAIENLGKLLCLKTLPASAAITPATTTPQTPNTPSSVEIWLQQAIPVQQSCKANES
CSSYSQCVCDKNCGKEALCAWLLKKEGRDKNGVSVDKNNPSKQSILDYQEQEQKVQAILE
AWLYPSEPRKTMGSTSPVMSSLSAWLSPPASQGEKASMEEHSSQFNGPKSESPLSKPLQP
ECWILPEKTHSSTAATPSQETTKEQPSTEPEEDKWLVRKRANAQERLAPPTVCDLFSCME
IGGDKEKWLHRVPIQM
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgtttactgtggaagagcgagagaaggccaccctcaggcagtgtgtgcaggcccgctgt
cagctggaggacgccatcggcggggtgacgagggctgaggtccagctccaggataactcc
agagaggtgaagtcccagcttcacacctgtatcagcagacacctggagtctatgcgttcc
cgtgaggtgtggctcctggagcagattgaccttgtgcagcagctaaagggagaggctctg
caggcacagctacatcagcttcacttgctccgaggccagtttgacattctcatccatcag
ctggaaaactccaacagcaacgacctggccaaccagctcaccggctgcatggaaaagtta
tcttctctgaacctgactcctgaggaaacccctgagatgagcttccaggctgacactcgt
tccctgcgccaggccatcacctcctttggcaccattgccacccagcacgtggaaggaggc
cctgtgctgaatatcgcctctcaaagctcaaatgccagcgagcgacaatggcttcaggag
ggttgtccaatcgcagctaagaaacagagggtggagtctgcacctcttgccgactggctc
cttggaaaccgtccagagactactgccccagttggataccagtcgagcaagaacccacag
gattggttgatcacccgcagggatgttcagtcatcttgccccatggccccctttgacttc
cacaaggcctggggccagctgaataatctggagatgtggctgcaaaagaagactcccatc
agagagagaaccagctgtagcagcagctcaaccttctccatcgagaaaatcgatgagtct
gagttagacatggctctggaggaagaggtgggccaagaggaggaggagcaagagtgggct
aagactgatgacctgagcgactggctcatcaccccggcaactgttgccaaggaaaccacc
agcaagagctgccaggcatctgaacctgacaggtggaagcagatcttcaaacctttccag
gagggcttctcctccagcgagtggctgctcaaatccgactgcggatcgtgctgtgcgacc
cacaccaagcctgtggcgattgagaacctgggcaaactcttgtgtctgaagaccctccca
gcctcagcagccatcacccctgccaccaccacaccccaaacccccaacacacccagctct
gtggagatctggctgcagcaggctattccagtacagcagtcgtgcaaagccaacgagtcc
tgctccagctactctcagtgtgtgtgtgacaagaactgcggcaaagaagccctctgcgcc
tggctcctcaagaaggagggtcgggacaagaacggggtctctgtggacaagaacaacccc
agcaagcagtccatcctcgactatcaagagcaagaacagaaggttcaggccatcctggag
gcctggctctaccctagcgagcctcgcaagaccatgggttccacatccccagtcatgtca
tccctctcagcctggttgtctccaccagcctcccagggtgaaaaggccagcatggaggaa
cacagctcccagttcaatggccccaagtcagaaagtcctttaagcaaaccactgcagcca
gagtgctggattttacctgagaagacacacagtagcaccgctgccacaccgagtcaggag
acaacaaaggagcaacccagcacagaaccagaggaagacaagtggcttgtccgcaagagg
gccaatgctcaggagcgacttgcccctcccacagtatgtgatctattttcctgtatggaa
atcggtggagacaaagagaagtggctacacagggtccctatacagatgtga

DBGET integrated database retrieval system