KEGG   Salmo salar (Atlantic salmon): 100306842
Entry
100306842         CDS       T04363                                 

Gene name
crk
Definition
(RefSeq) v-crk sarcoma virus CT10 oncogene homolog (avian)
  KO
K04438  C-crk adapter molecule crk
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100306842 (crk)
   04012 ErbB signaling pathway
    100306842 (crk)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100306842 (crk)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100306842 (crk)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100306842 (crk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    100306842 (crk)
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   100306842 (crk)
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9
Other DBs
NCBI-GeneID: 100306842
NCBI-ProteinID: NP_001158853
UniProt: C0H993
LinkDB
Position
ssa09
AA seq 306 aa
MAGNFDAEDRASWYWGRLSRQEAVSLLQGQRHGVFLVRDSITSPGDYVLSVSENSKVSHY
IINSISNNRQSGAGLTPPQFRIGDQEFDALHSLLEFYKIHYLDTTTLIEPINKAKHSSLV
SAGAGGPPQRLEDELVRAVFDFPGNDDEDLPFRKGDILRVLEKPEEQWWNAQNLEGRAGM
IPVPYVEKYRPASPTSGGSGAGGPGGVGSVDGSSVQGPPLLDPSQYAQPTPLPNLQNGPV
FARAIQKRVPNAYDKTALALEVGDMVKVTKINVNGQWEGECKGKRGHFPFTHVKLLDHNN
PEDEVS
NT seq 921 nt   +upstreamnt  +downstreamnt
atggccggaaattttgacgcagaggaccgtgcaagttggtactggggaagattaagtaga
caggaggcagtttcacttttacaaggacagagacacggagtgtttttagtgagagactca
attacaagtccaggcgactacgtgctgtccgtctcagagaattccaaagtctcgcattac
atcatcaacagcatcagcaacaaccggcagtctggcgcaggcctaacgcctccacagttt
cgcataggggaccaggagtttgatgccctccattccctgctagagttctacaagatccac
tacctggacaccaccactctgatagagcccatcaacaaggccaaacactcttccttggtc
agcgcaggtgctggaggcccaccgcagcggctggaagacgagctcgtccgcgccgtcttt
gatttcccaggcaacgacgatgaggaccttcctttcagaaagggcgacatcctgcgggtt
ctggagaagcctgaggagcagtggtggaatgcccagaatttagaggggcgtgccgggatg
atacctgtgccctacgtggagaagtaccgaccggcctctcccacctcggggggctctgga
gcagggggtcccggtggggtgggctcggtagatggctccagtgttcagggacctcctctg
ctagacccgagccagtatgcccagcccacacctctgcccaacctgcagaacggacccgtc
tttgccagggccatccagaagagggtgcccaatgcctacgacaagaccgcccttgcctta
gaggtgggcgacatggtgaaggtgacaaagatcaacgtgaacggccagtgggagggcgag
tgcaagggcaagcgcggccacttccccttcacccacgttaagctgctggaccataataac
cccgaggacgaggtgagctga

KEGG   Salmo salar (Atlantic salmon): 106563168
Entry
106563168         CDS       T04363                                 

Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106563168
   04012 ErbB signaling pathway
    106563168
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106563168
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106563168
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106563168
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    106563168
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   106563168
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9
Other DBs
NCBI-GeneID: 106563168
NCBI-ProteinID: XP_013983930
UniProt: A0A1S3KZC3
LinkDB
Position
ssa11
AA seq 304 aa
MSSARFDSSDRSSWYFGPVSRQEAQNRLQGQRHGMFLVRDSSTCPGDYVLSVSENSKVSH
YIINSLPSKRFKIGDQEFELLPALLEFYKIHYLDTTTLIEPAPRYPNTAIGTGPIQTMGG
PEDNLEYVRTLYDFTGSDTEDLPFKKGEILIILEKPEEQWWSAKSKEGRVGMIPVPYVEK
LVRPSPHPGQPPHSSRNSNSYGIPEPAHAYAQPQTPSPLPPGTPGAVITPLPSMQNGPVM
AKAIQKRVPCAYDKTALALEVGDIVKVTRMNISGQWEGEVNGRRGLFPFTHVKIIDPLNP
DECE
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtcatctgcacggtttgattcatcggaccggtccagttggtattttgggccggtgtcg
agacaggaggcgcagaatagattacaaggacagaggcatggcatgtttttggttcgggat
tcctctacctgccctggcgactatgtgctgtcagtatctgaaaactccaaagtgtcccac
tatatcatcaactccttgccaagcaagaggttcaagatcggtgaccaagaattcgagctc
ctcccagctcttttggagttctacaaaatccactacctggatacgactacactgatagaa
cctgcccccaggtaccctaacacagcgataggcaccggccccattcagacgatggggggc
ccagaggacaacctggagtatgtgcgaactctgtacgacttcacgggcagcgacactgag
gacctgcccttcaaaaagggggagatcctgatcatcctggagaagcctgaggagcagtgg
tggagcgccaagagcaaggagggccgtgtgggcatgatccctgtgccctatgtggaaaag
ctggtgcgaccctcccctcaccctggccagccccctcacagctcccgcaactccaacagc
tatggcatcccagagccggcccacgcttacgcccagcctcagacgccctcgcccctgcct
cctggcacccctggagcggtcatcacccccctaccctccatgcagaacgggccagtcatg
gctaaggccatccagaaacgagtgccctgtgcatatgacaagactgccctggctctagag
gtgggtgatatagtcaaagtgacgaggatgaacatcagcggtcagtgggagggagaggta
aacggccggagaggtctcttccccttcacccacgtcaaaataatagaccccctgaatcca
gatgagtgtgaatga

KEGG   Salmo salar (Atlantic salmon): 106566436
Entry
106566436         CDS       T04363                                 

Definition
(RefSeq) crk-like protein
  KO
K04438  C-crk adapter molecule crk
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106566436
   04012 ErbB signaling pathway
    106566436
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106566436
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106566436
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106566436
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    106566436
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   106566436
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9
Other DBs
NCBI-GeneID: 106566436
NCBI-ProteinID: XP_013989947
UniProt: A0A1S3LG93
LinkDB
Position
ssa01
AA seq 304 aa
MSSARFDPSDRSSWYFGPVSRQEAQNRLQGQRHGMFLVRDSSTCPGDYVLSVSENSKVSH
YIINSLPSMRFKIGDQEFEHLPALLEFYKIHYLDTTTLIEPAPRYPNTAIGTSPIQTMGG
PEDNLEYVRTLYDFTGSDAEDLPFKKGEILIILEKPEEQWWSAKSKEGRMGMIPVPYVEK
LVRPSPQPGQPLHGSRNSNSYGIPEPAHAYAQPQTPSPLPPGTPGAVITPLPSMQNGPVM
AKAIQKRVPCAYDKTALALEVGDIVKVTRMNISGQWEGEVNGRRGLFPFTHVKIMDPQNP
DESE
NT seq 915 nt   +upstreamnt  +downstreamnt
atgtcatctgcacggttcgatccatcggaccggtccagttggtattttgggccggtgtcg
agacaggaggcgcagaatagattacaaggacagaggcatggcatgtttttggttcgggat
tcctcgacctgccctggcgactatgtgctgtcagtatctgaaaattccaaagtttcccac
tatatcatcaactccttgccaagcatgaggttcaaaatcggcgatcaagaattcgagcac
ctcccagcacttttggagttctataaaatccactacctggatacgactacactgatagaa
cctgcccccaggtacccaaacacagctataggcaccagccccattcagacgatgggcggc
ccagaagacaacctggagtatgtgcggactctgtacgacttcacgggcagcgatgctgag
gacctgccctttaagaagggggagatcctgatcatcctggagaagcctgaagagcagtgg
tggagtgccaagagcaaggagggccgcatgggcatgatccctgtgccctatgtggagaag
ctggtgcgaccctcccctcaacctggccagcctcttcacggctcccgcaactccaacagc
tatggcatccccgagccggcccacgcttacgctcagcctcagaccccctcgccccttccc
cctggcacccccggagcggtcatcacccccctgccctccatgcagaacgggccagtcatg
gctaaggccatccagaaacgagtgccctgtgcctatgacaagacggccctggctctagag
gtgggtgatatagtcaaagtgacgaggatgaacatcagcggtcagtgggagggagaggtg
aatggccggaggggtctcttccccttcacccatgtcaaaataatggacccccagaatccg
gatgagagtgaatga

KEGG   Salmo salar (Atlantic salmon): 106567578
Entry
106567578         CDS       T04363                                 

Definition
(RefSeq) adapter molecule crk-like
  KO
K04438  C-crk adapter molecule crk
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106567578
   04012 ErbB signaling pathway
    106567578
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106567578
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106567578
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106567578
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    106567578
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   106567578
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9 hSH3
Other DBs
NCBI-GeneID: 106567578
NCBI-ProteinID: XP_013992536
UniProt: A0A1S3LNS8
LinkDB
Position
ssa13
AA seq 323 aa
MAGNFDAEDRASWYWGRLSRQEAVSLLQGQRHGVFLVRDSITSPGDYVLSVSENSKVSHY
IINSISNNRQSGSGLAPPRFRIGDQEFDALPALLEFYKIHYLDTTTLIEPISKAKHAGFV
SCAAAAPGGALQEAEFVRALFDFPGNDEEDLPFRKGDVLRVLEKPEEQWWNAANQEGRVG
MIPVPYVEKYRPASPNSLGAPAAGRPGGAGGVGGVAAGVGGSTTDGAAPQLPPPLGEPGQ
YAQPVGNTPLPNLQNGPVYARAIQKRVPNAYDKTALALEVGDMVKVTKINVNGQWEGECK
GKHGHFPFTHVRLLDHQHPEEES
NT seq 972 nt   +upstreamnt  +downstreamnt
atggccgggaattttgatgccgaggaccgtgctagctggtactggggaaggttgagccga
caggaggcggtttctctcttgcagggtcagagacatggcgtgttcctggtcagggactcg
attaccagtcctggggactacgtgctatctgtctcagaaaactcaaaagtctcacattat
ataattaacagcatcagcaacaaccggcaatctggatcaggtctggcccccccgcggttc
cgcatcggggatcaggagtttgatgccctacccgccctgctggagttctacaagatccac
tacctggacaccaccacgctgatcgaacccatcagcaaggccaagcatgcgggcttcgtg
agctgtgccgccgctgccccggggggcgccctgcaggaggcagagtttgttcgcgccctc
tttgacttccctggcaacgatgaggaggacctgcccttccgcaagggagatgtgctgcgc
gtgctggagaagcctgaggagcagtggtggaacgcggccaaccaagagggccgtgtcggc
atgattcccgtgccctacgtggagaagtaccggcctgcctcgcccaactccttgggggct
ccggcggcagggagacccggcggggcaggaggagtaggcggagtagcggcaggtgttgga
ggcagcactaccgacggagcagctccccagctgcccccgcctctgggggagccgggccag
tatgcccagcccgtgggcaatacacccctgcccaacctgcagaacgggcctgtctacgcc
cgtgccattcagaagagggtgcccaacgcctacgacaagacggccctcgccttggaggtc
ggagacatggtaaaagtgaccaagatcaacgtgaacggccagtgggagggcgagtgcaag
ggcaagcatggccactttcccttcacgcacgtccggcttctggaccaccaacaccctgag
gaggagagctga

KEGG   Salmo salar (Atlantic salmon): 106580783
Entry
106580783         CDS       T04363                                 

Definition
(RefSeq) adapter molecule crk-like
  KO
K04438  C-crk adapter molecule crk
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106580783
   04012 ErbB signaling pathway
    106580783
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106580783
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106580783
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106580783
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    106580783
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   106580783
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9
Other DBs
NCBI-GeneID: 106580783
NCBI-ProteinID: XP_014017665
UniProt: A0A1S3NR00
LinkDB
Position
ssa20
AA seq 308 aa
MAGNFDAEDRASWYWGRLSRQEAVSLLQGQRHGVFLVRDSITSPGDYVLSVSENSKVSHY
IINSISNNRQSGSGQAPPRFRIGDQEFDALHSLLEFYKIHYLDTTTLIEPINKAKHSPLV
GVNAGAGGPSQRQEDEMVRALFDFPGNDDEDLPFRKGDILRVLEKPEEQWWNAKNLEGRA
GMIPVPYVEKYRPASPTSGGSGTGGPGGVGSVDGSSAQGPPLLDPSQYAQPTPLPNLQNG
PVFARAIQKRVPNAYDKTALALEVGDMVKVTKINVNGQWEGECKGKRGHFPFTHVKLLDH
NSPEEDVS
NT seq 927 nt   +upstreamnt  +downstreamnt
atggccggaaattttgacgcagaggatcgtgcaagttggtactggggaagattaagtaga
caggaggcagtttcacttttacaaggacagagacacggagtgtttttggtgagagactct
attacaagccctggcgactacgtcctgtccgtttcagagaattccaaagtctcgcattac
ataatcaacagcatcagcaacaaccggcagtctggctcaggccaggcgcctccacggttc
cgcataggtgaccaggagtttgacgccctccattccctgctggagttttacaagatccac
tacctggacaccaccacactgatagagcccatcaacaaggccaaacactctcccttggtc
ggtgtcaacgcaggtgctggaggcccgtcgcagcggcaggaagacgagatggtccgtgcc
ctcttcgacttcccgggcaacgacgatgaggatctgcctttcagaaagggcgacatcctg
cgggtcctggagaagcctgaggagcagtggtggaatgccaagaatttagaggggcgtgcc
gggatgatccctgtgccctacgtggagaagtaccgaccggcctctcccacctcggggggc
tctggaacagggggtccaggtggggtgggctcggtagacggctcaagtgctcagggacca
cctctgctagacccgagccagtacgcccagcccacacctctgcccaacctgcagaacgga
cccgtctttgccagggccatccagaagagggtgcccaatgcctacgacaagaccgccctt
gccttagaggtgggcgacatggtgaaggtgacaaagatcaacgtgaacggccagtgggaa
ggcgagtgcaagggcaaacgaggccacttccccttcacccatgttaagctgctggaccat
aacagccctgaggaagacgtgagctga

KEGG   Salmo salar (Atlantic salmon): 106603721
Entry
106603721         CDS       T04363                                 

Definition
(RefSeq) adapter molecule crk-like
  KO
K04438  C-crk adapter molecule crk
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106603721
   04012 ErbB signaling pathway
    106603721
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106603721
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106603721
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106603721
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    106603721
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   106603721
SSDB
Motif
Pfam: SH3_2 SH3_1 SH2 SH3_9
Other DBs
NCBI-GeneID: 106603721
NCBI-ProteinID: XP_014053226
UniProt: A0A1S3RLN0
LinkDB
Position
ssa04
AA seq 319 aa
MAGNFDAEDRASWYWGRLSRQDTVFLLQGQRHGVFLVRDSITSPGDYVLSVSENSKVSHY
IINSISNNRQSGSGLAPPRFRIGDQEFDALPILLEFYKIHYLDTTTLIEPISKAKHTSLA
SCAATAPPTASGSAPQEAEFVRALFDFPGNDEEDLPFRKGDVLRVLEKPEEQWWNAANQE
CRAGMIPVPYVEKYRPASPTSVAGGPGGAGGPSGVGGSTTDGAAPQLPPPLGEPGQYAQP
MVNTPLPNLQNGPVYARAIQKRVPNAYDKTALALEVGDMVKVTEINVNGQWEGECKGKRG
HFPFTHVRLLDHQHSEDES
NT seq 960 nt   +upstreamnt  +downstreamnt
atggccgggaattttgatgcggaggatcgtgctagctggtactggggaaggttgagccga
caggatacggttttcctcttgcagggtcagagacatggcgtgtttctcgtaagggactct
attaccagtcccggggactacgtgctatccgtctcagagaactcaaaagtatcacattat
ataatcaacagcatcagcaacaaccggcaatctggatcaggtttggcccctccgcggttc
cgcatcggggaccaggagtttgacgccctgcccatccttctggagttctacaagatccac
tacctggacaccaccacactgatcgagcccatcagcaaggccaagcacacgagcttggcg
agctgtgctgccaccgcccctcccactgcatcgggcagcgccccgcaggaggcagagttt
gttcgcgccctcttcgacttcccaggcaacgacgaggaggacctgcccttccgcaagggt
gacgtgctgcgtgtgctggagaagcctgaggagcagtggtggaacgcggctaaccaggag
tgccgcgccggcatgatccccgtaccctatgtagagaagtaccggcccgcctcacccacc
tcggtggcgggggggcccggaggtgcgggagggccgtcgggtgttgggggcagcactacg
gatggagcagcgccccagctgcccccgcctctgggagagccaggccagtatgcccagccc
atggtcaacactcccctgccaaacctgcagaacgggcccgtctatgcccgcgccattcag
aaaagggtgcccaacgcctacgacaagacggccctcgccttggaggtcggagacatggtg
aaagtgaccgagatcaacgtgaacggccagtgggagggcgagtgcaagggcaagcgcggc
cactttccctttacgcatgtccggctgctggaccaccagcactccgaggacgagagctga

DBGET integrated database retrieval system