KEGG   Salmo salar (Atlantic salmon): 100306852
Entry
100306852         CDS       T04363                                 

Gene name
ccnd1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100306852 (ccnd1)
   04340 Hedgehog signaling pathway
    100306852 (ccnd1)
   04371 Apelin signaling pathway
    100306852 (ccnd1)
   04068 FoxO signaling pathway
    100306852 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100306852 (ccnd1)
   04115 p53 signaling pathway
    100306852 (ccnd1)
   04218 Cellular senescence
    100306852 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100306852 (ccnd1)
   04530 Tight junction
    100306852 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100306852
NCBI-ProteinID: NP_001158863
UniProt: C0H9B3
LinkDB
Position
ssa16
AA seq 292 aa
MEHQLLCCEVETIRRAYQDSNLLNDRVLQTMLKAEDNYLPATNYFKCVQKEIVPCMRRIV
STWMLEVCEEQKCEEEVFPLAMNFLDRYLSVEPTKKTRLQLLGATCMFLASKMKETIPLT
AEKLCIYTDNSIRTGELLQMELLVLNKLKWDLASVTPHDFIDHFLSKLPIHQDTKQILCK
HAQTFVALCATDVKFIANPPSMIAAGSVAAAVQGLNLKSMDDALSSQQLTDFLSQVIRSD
PDCLRACQEQIESLLETSLRQAQQHTVSTDTKSMDEEVDLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacaccagttgctgtgctgtgaagtggagaccatccggagagcttaccaagactcg
aatctgctcaacgacagagttctgcagactatgctaaaagctgaagacaattatctcccc
gcaacgaactacttcaaatgtgtacagaaagagattgtaccctgcatgaggagaattgtt
tctacatggatgctggaggtctgtgaggaacagaaatgcgaagaggaggtttttccccta
gctatgaattttttagacagatatttgtctgttgaacccacgaagaagactcggctacag
ttattgggcgctacctgcatgtttctggcgtctaaaatgaaggagaccattcctctaaca
gctgagaagttgtgcatatacacagacaattccatccggacgggcgagttgctgcaaatg
gagctactggtattgaacaaactgaaatgggatctagcctcagttactccacacgatttc
atagaccacttcctctccaagctacccatccatcaggacaccaagcaaatcctgtgcaag
catgcccagacctttgtggctctctgtgctacagatgtcaaattcattgccaaccctccg
tcaatgatcgcagcgggcagtgtggcggctgctgtccaggggctgaatctgaagagcatg
gacgatgcactgtcatcccagcaactcactgacttcctgtctcaagtcatcagaagtgac
ccggattgtctacgggcgtgtcaagaacagatcgagtccttattggagaccagtctccgt
caggcacagcaacacactgtttccacggacaccaagagcatggatgaggaggtcgacctg
tcgtgcacgccaacggacgttagagatgtgaacatctga

DBGET integrated database retrieval system