KEGG   Salmo salar (Atlantic salmon): 100380346
Entry
100380346         CDS       T04363                                 

Gene name
myc2
Definition
(RefSeq) Transcriptional regulator Myc-2
  KO
K04377  Myc proto-oncogene protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04110  Cell cycle
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04350  TGF-beta signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100380346 (myc2)
   04012 ErbB signaling pathway
    100380346 (myc2)
   04310 Wnt signaling pathway
    100380346 (myc2)
   04350 TGF-beta signaling pathway
    100380346 (myc2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100380346 (myc2)
   04218 Cellular senescence
    100380346 (myc2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100380346 (myc2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    100380346 (myc2)
   03019 Messenger RNA biogenesis [BR:sasa03019]
    100380346 (myc2)
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    100380346 (myc2)
Messenger RNA biogenesis [BR:sasa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100380346 (myc2)
SSDB
Motif
Pfam: HLH Myc_N Myc-LZ
Other DBs
NCBI-GeneID: 100380346
NCBI-ProteinID: NP_001167102
UniProt: C0H9V6
LinkDB
Position
ssa12
AA seq 383 aa
MLQSFSQSQDWFYSEPLLFDDEFCQSLMKDLQSLPTPPQSPPMKVGLNAKPLSKEDQLSY
VSDILLEDQDPQLNWNFDILYDGNATGTKDQQPEESDDCLWHCLSDKSMEEKLSSVLSSS
PLLSDIDTRIFEEIAGSTLDCHTAALACQALENEGLLLDRQDRQEQGSESTSDYGSAGGE
FSTYWSSASDTEEEIDVVTVKRTASPSQSVEECRRQQRAIKRQHLEIQLQHNYAAPCPTS
PLRPEVSTASNSHHKRSRVSDPHRHHHHGSSGRSSSSRHYLSSHHQSSSSRQSPDMEDEE
EKRHTHNVMERQRRNELKNCFLRLRDNVPELSNNDKASKVVILKRARDSIRGLELEGQRL
NAKRDKLRDGQEQLKAKLEQLRR
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgctgcagagtttctctcagtcgcaagattggttctactcggagcctctcttatttgat
gatgaattctgccagagcttgatgaaggacctacagtcgctccccacgccaccccagtcc
cctccgatgaaggttggactcaatgccaaaccactttccaaggaggaccagttgagctac
gtctctgatatactcctggaggatcaagacccacaactaaattggaattttgacattttg
tacgatggcaatgcaaccggaacaaaggaccaacagccagaggagtccgacgactgtttg
tggcattgcctcagtgataagtctatggaggagaagctatcgtccgtgctctccagcagc
ccgctgctctcggacatagacacgagaatttttgaggaaattgctggctccacactggac
tgccacactgcggcactcgcgtgccaagctttggagaatgagggtttactattggacagg
caggaccgtcaggagcaaggcagcgagtcgacctccgactacggctcggcaggaggtgaa
ttctcaacttattggagcagtgctagcgatactgaggaggagatagacgtagtgactgtg
aagaggactgccagcccctcccagtcggtagaggagtgccggcggcaacagcgcgccatc
aagcgccaacacctggagatccagctgcagcacaattatgctgccccctgccccacgtcg
ccccttcgcccagaggtctcgaccgcctcaaactcccaccacaagcgctcccgggtctcc
gatccgcacagacaccaccaccacggctcgtcgggccgctcatcctcgtcccgccactac
ctcagcagtcaccaccagtccagctcctctaggcagtcgccggacatggaggacgaggag
gagaagaggcatacccacaatgtgatggagaggcagcggcgcaacgagctgaagaactgc
ttcctgcggctcagggacaacgtacccgagctgtccaataacgacaaggcctccaaggtg
gtcattctgaagagggcacgtgacagcatccgcggcctggagctggagggccagagactg
aacgccaagcgagacaagctccgagacgggcaggagcagctcaaagctaaactggagcag
ctcaggaggtaa

KEGG   Salmo salar (Atlantic salmon): 100380531
Entry
100380531         CDS       T04363                                 

Gene name
myc
Definition
(RefSeq) Viral myc transforming protein
  KO
K04377  Myc proto-oncogene protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04110  Cell cycle
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04350  TGF-beta signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100380531 (myc)
   04012 ErbB signaling pathway
    100380531 (myc)
   04310 Wnt signaling pathway
    100380531 (myc)
   04350 TGF-beta signaling pathway
    100380531 (myc)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100380531 (myc)
   04218 Cellular senescence
    100380531 (myc)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100380531 (myc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    100380531 (myc)
   03019 Messenger RNA biogenesis [BR:sasa03019]
    100380531 (myc)
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    100380531 (myc)
Messenger RNA biogenesis [BR:sasa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100380531 (myc)
SSDB
Motif
Pfam: HLH Myc_N Myc-LZ DUF3602
Other DBs
NCBI-GeneID: 100380531
NCBI-ProteinID: NP_001167287
UniProt: C0HB65
LinkDB
Position
ssa22
AA seq 382 aa
MLQSFSQSQDWFYSEPLLFDDEFCQSLMKDLQSLPTPPQSPPLKTGLNAKPLSKEDQLSY
VSDILLEDQDPQLNWNCDFLYDGSATETKDQQPDESDDCLWHCLGDKSMEKLSSVLSSSP
LLSDIDTSIFEEIAGSTLDCHSTALACQALENEDLLLDSQEQGSESTSDYGSAGGEFSTY
SSSASDSEEEIDVVTVKRTTSPSSLSQSVEESRRRQRALKRQHLEIQLQHNYAAPCPASP
LRSEPSSASYHKRTRSSDSHRHHHHSSSGRSSRHNLSSHQHQSSSRQSTDVEDEEERRHT
HNVMERQRRNELKNCFLRLRDNVPELSNNDKASKVVILKRACDSIRGLELAGQRLNVKRD
KLRERQEQLKVKLEQLRRQRCD
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgctgcagagtttctcccagtcgcaagactggttctactcagagcctcttttgtttgat
gatgaattctgccagagcttgatgaaggacctacagtcgctccccacgccaccccagtcc
cctccattgaagactggactcaatgccaaaccactttccaaggaggaccagttgagctac
gtctcggacatactcctggaggatcaggacccgcaactaaattggaattgtgactttttg
tacgatggcagtgcaaccgagacaaaggaccaacagccagatgagtccgacgactgttta
tggcattgcctcggtgataagtctatggagaagctatcatctgtactctccagcagcccg
ctgctctcggacatagacacaagcattttcgaggaaattgccggctccacactggactgc
cacagcacggcgctcgcatgccaagctttggagaatgaggatttactattggacagtcag
gagcaaggcagcgagtcgacttcagactatggctcagcaggaggtgaattctcaacgtat
tcgagcagtgccagtgattctgaggaggagatagacgtggtgacagtgaagaggaccacc
agcccctcctccctctcccagtcggtagaagagagccggcggcggcagcgcgccctaaag
cgtcaacacctggagatccagctgcagcacaactacgctgccccctgccctgcatcgccc
ctccgctcagagccctcatccgcttcctaccacaaacgaacccggtcctccgactcccac
agacaccaccaccacagctcgtcgggccgctcgtcccgacacaacctcagcagtcaccaa
caccagtctagctctaggcagtcgactgatgtggaggatgaggaggagaggaggcatacc
cacaatgtgatggagaggcaacggcgcaacgagctgaagaactgtttcctgcggctcagg
gacaacgtgcctgagctgtccaacaacgacaaggcctccaaggtggtcatcctgaagagg
gcatgcgacagcatccgtggcctggagctggcgggccagagactgaatgtcaagcgagac
aagctcagagagaggcaggagcagctcaaagttaaactggagcagctcaggaggcaacgg
tgcgactga

KEGG   Salmo salar (Atlantic salmon): 106568625
Entry
106568625         CDS       T04363                                 

Gene name
myc
Definition
(RefSeq) v-myc avian myelocytomatosis viral oncogene homolog
  KO
K04377  Myc proto-oncogene protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04110  Cell cycle
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04350  TGF-beta signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106568625 (myc)
   04012 ErbB signaling pathway
    106568625 (myc)
   04310 Wnt signaling pathway
    106568625 (myc)
   04350 TGF-beta signaling pathway
    106568625 (myc)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106568625 (myc)
   04218 Cellular senescence
    106568625 (myc)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106568625 (myc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106568625 (myc)
   03019 Messenger RNA biogenesis [BR:sasa03019]
    106568625 (myc)
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    106568625 (myc)
Messenger RNA biogenesis [BR:sasa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     106568625 (myc)
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ CAF1A
Other DBs
NCBI-GeneID: 106568625
NCBI-ProteinID: XP_013994567
UniProt: A0A1S3LUE5
LinkDB
Position
ssa14
AA seq 401 aa
MPLNSNMASKNYDYDYDSVQPYFYFDIEEENFYHRQHSQLQPPAPSEDIWKKFELLPTPP
LSPSRRPSLSSLFPSTADQLEMVTEFLGDDVVNHSFICDADYSQSFLKSIIIQDCMWSSF
SAAAKLEKVVSERLATLQARRDSSATGEASTVTSTNPNLNYLQDLNNSASECIDPSVVLF
PYPVAENPKHTQTTACAMALPLDTPPNSGSSSDSDSEEEEEEEEEEEEIDVVTVEKRKSV
RRSDSHMSSSTHLCPLVLKRCHVNIHQHNYAAHPSTRSEQPVKRIKFESSGRVLKQISNN
RKCLSPRTSDSEDNDKRRTHNVLERQRRNELKLSFFALRDEIPDVANNEKAAKVVILKKA
TECIFSMQMDEQKLLLLKEQLRKKSEQLTSRLEQLRNSQQV
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgccgctgaattcaaacatggctagtaaaaactatgattacgactatgactcggtccag
ccctacttctacttcgacattgaggaggaaaatttctatcaccggcaacacagccaactc
caaccccctgctccaagcgaggatatatggaagaaattcgagctgctgccgacaccaccg
ctttctcccagccggagaccgtctttatcaagcctcttcccctccactgcagaccagctg
gagatggtcacggagtttctcggggacgacgtggtgaaccatagtttcatttgtgatgcg
gactactcccagtcttttctcaaatctatcattatccaggactgtatgtggagcagtttc
tcggctgccgctaaactggagaaagtagtgtccgagagactagcaacgctgcaagcgagg
agggactctagtgcgaccggggaagctagtacagtaaccagcacaaatccaaacttgaat
tacctgcaagacctgaacaactccgcatcggaatgcattgacccttctgtggtgttgttc
ccttacccggttgccgagaaccctaaacacacacagactacagcgtgtgccatggcattg
cctttggataccccaccaaacagtggtagcagcagcgatagcgattcagaagaagaagag
gaggaggaggaggaagaagaagagattgatgtggtgacagtggaaaagagaaagtctgta
aggaggtcagactcgcacatgtctagcagcacacacctctgcccccttgtcctgaaacgg
tgtcacgtcaacatccaccaacacaactacgccgctcacccgtcgacgaggagcgagcag
cccgtcaagaggattaaatttgagagcagtgggagagtactcaagcaaatcagcaacaac
cgcaagtgcttgagtcccagaacgtcagactctgaggataatgacaaacgcaggactcac
aatgtgctggagaggcaaaggcgaaacgagctgaagttgagcttttttgcattacgggac
gagatcccggacgtagcgaacaatgagaaggcagccaaagtggtcatactcaaaaaggca
acggagtgcattttcagtatgcaaatggacgagcagaaactgttattgttgaaagagcag
ttgaggaaaaagagtgaacagttgacaagcagactagagcagctaaggaactctcagcaa
gtttaa

KEGG   Salmo salar (Atlantic salmon): 106578682
Entry
106578682         CDS       T04363                                 

Definition
(RefSeq) transcriptional regulator Myc-like
  KO
K04377  Myc proto-oncogene protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04110  Cell cycle
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04350  TGF-beta signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106578682
   04012 ErbB signaling pathway
    106578682
   04310 Wnt signaling pathway
    106578682
   04350 TGF-beta signaling pathway
    106578682
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106578682
   04218 Cellular senescence
    106578682
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106578682
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106578682
   03019 Messenger RNA biogenesis [BR:sasa03019]
    106578682
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    106578682
Messenger RNA biogenesis [BR:sasa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     106578682
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ
Other DBs
NCBI-GeneID: 106578682
NCBI-ProteinID: XP_014013249
UniProt: A0A1S3NCS6
LinkDB
Position
ssa19
AA seq 441 aa
MVVWREKRCGGGIGGVFLLNPGEYSAVILLQQMTSDITDKELESATMQLYSSLASKNYDY
DSIQPYFYVDNEDEDFYHQQQGQLQPPAPSEDIWKKFELLPTPPLSPSRRPSLSSLFPST
SDQLEMVTEFLGDDVVNQSFICDADYSQPFLKSIIIQDCMWSGFSAAAKLEKVVSERLAS
LQAARKESAFSDNAEWTTTRLNANYLQDLNTSASECIDPSVVFPYPITDTSKSSKVAPPT
DLALDTPPNSSSSSGSDSEYEEIDVVTVEKRHAEKRCDPNMSGTRHHSPLVLKRCHVSTH
QHNYAAHPSTRHEQPAVKRLRLESSNSGSSSSRVLKQISSNRKCPSPWTSDTEDYDKRRT
HNVLERQRRNELKLSFFALRDKIPEVANNEKAAKVVILKKAIECIYSMQTDEQRLVNFKE
QLTRKSEHLKQKLARLQDSHV
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggtggtttggcgggaaaagagatgcggcggagggatcggtggagtgtttttactgaac
ccgggtgaatactcagctgtgattctcctgcagcagatgacatccgacatcacggacaaa
gagctggaaagcgcgacaatgcagctatattcaagtttggcaagtaaaaactacgactac
gactctatccagccatatttttatgttgataacgaagatgaggatttttatcaccagcaa
caaggacaacttcagccacctgctccaagtgaggacatctggaagaaatttgagttgctg
cccactcctcctctctccccgagccggcgaccatcactgtctagtcttttcccttcaact
tcagaccaactcgaaatggtgacagagtttctcggggatgacgttgtaaaccagagtttc
atctgcgatgccgattactctcaacccttcctcaagtctatcatcatccaggactgtatg
tggagcgggttctcggctgcagccaagttggaaaaagtggtgtctgaaagactcgccagt
ctccaggctgctaggaaagaatcagcttttagcgacaacgcggagtggactactactcgg
ttgaacgcaaactacttgcaggatctgaacacatccgcgtcagaatgcattgatccctca
gtggtctttccctatccaataactgatacttccaaatcaagcaaggtggcaccacccacg
gatttggcattggacaccccacccaacagcagtagcagcagtggtagtgactcagaatat
gaggagatagatgtcgtgactgtggagaagaggcacgcagagaagcggtgcgaccccaac
atgtctgggaccagacatcacagtccccttgtgctgaagaggtgccatgtctccacccac
cagcacaactacgcagctcacccctccacgcggcacgagcaaccggctgtcaagaggctg
aggctagagagtagtaacagtggcagcagcagcagccgggtcctcaagcagattagcagc
aaccgcaaatgcccaagtccctggacgtcagacactgaggactatgacaaaagaaggact
cataatgtactggagcgccagcggaggaacgagctcaagctgagctttttcgctctacgg
gacaagataccggaggtggctaacaacgaaaaggcagccaaagtggtcatcctgaagaag
gctatagagtgtatttacagcatgcagacagacgagcagagactagtcaacttcaaagag
cagctaacgaggaaaagtgaacatttgaaacagaagctggcccggttgcaggactctcat
gtttga

KEGG   Salmo salar (Atlantic salmon): 106590162
Entry
106590162         CDS       T04363                                 

Gene name
c-myc
Definition
(RefSeq) transcriptional regulator Myc
  KO
K04377  Myc proto-oncogene protein
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04110  Cell cycle
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04350  TGF-beta signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106590162 (c-myc)
   04012 ErbB signaling pathway
    106590162 (c-myc)
   04310 Wnt signaling pathway
    106590162 (c-myc)
   04350 TGF-beta signaling pathway
    106590162 (c-myc)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106590162 (c-myc)
   04218 Cellular senescence
    106590162 (c-myc)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106590162 (c-myc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106590162 (c-myc)
   03019 Messenger RNA biogenesis [BR:sasa03019]
    106590162 (c-myc)
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    106590162 (c-myc)
Messenger RNA biogenesis [BR:sasa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     106590162 (c-myc)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH IATP
Other DBs
NCBI-GeneID: 106590162
NCBI-ProteinID: XP_014036304
UniProt: A0A1S3QA70
LinkDB
Position
ssa29
AA seq 403 aa
MPLNSSLASKNYDYDYDSIQPYFYVDNEDEDFYHQQPGQLQPPAPSEDIWKKFELLPTPP
LSPSRPSLSSIFPSTADQLEMVTEFLGDDVVNQSFICDADYSQTFLKSIIIQDCMWSGFS
ATAKLEKVVSERLASLHAARKDSAVGDIAECPTRLNANYLQDPNTSVSECIDPSVVFPYP
ITETPKPSKVAPPTDLALDTPPNSGSSSSSGSDSEDEEEDDEEEIDVVTVEKRQAVKRCD
PSTSETRHHSPLVLKRCHVSTHQHNYAAHPSTRHEQPAVKRLRLESSSSRVLKQISSNRK
CSSPRTSDTEDYDKRRTHNVLERQRRNELKLSFFALRDEIPDVANNEKAAKVVILKKATE
CIYSMQTDEQRLVNLKEQLRRKSEHLKQKLAQLQNSCLSSKRH
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgccgctgaattcaagtttggcgagtaaaaactacgactacgactatgattctatccag
ccatatttttatgttgacaacgaagatgaggatttctatcaccagcagccaggacagctt
cagccaccggctccaagcgaggacatctggaagaaatttgagttgctccccactcctcct
ctctccccgagccgaccatcactgtctagtattttcccatcgactgctgaccaactagaa
atggtgaccgagtttctcggggacgacgttgtaaaccagagtttcatctgcgatgccgac
tactcccaaaccttcctcaagtcaatcataattcaggactgtatgtggagcggcttctct
gctacagccaagttggagaaagtggtgtctgaaagactcgcttcgctccacgctgctagg
aaagattcagctgttggcgacatcgcagagtgtcctactcggttgaacgcaaactacttg
caggatccgaacacttccgtgtcagaatgcattgatccctcagtggtcttcccctaccca
ataactgagactcccaaaccaagtaaggtggcaccacccacggatttggcattggacacc
ccacccaacagtggtagcagcagcagcagtggtagtgactccgaagatgaggaggaagat
gacgaggaggagatagatgtcgtgactgtggagaagaggcaagcggtgaagcggtgcgac
cccagcacgtcagagaccagacatcacagtccccttgtgctgaagaggtgccatgtctcc
acccaccagcacaactacgctgcccacccctccacacggcacgagcagccagctgtcaaa
aggctgaggctggagagcagcagcagccgggtcctcaagcagatcagcagcaaccgcaaa
tgctcaagtccccggacgtcggacacggaggactacgacaaaagaaggactcataatgta
ctggagcgccagcggaggaacgagctcaagctgagctttttcgctctacgggacgagatt
cccgatgtggccaacaatgagaaggcagccaaagtggtcatcctcaagaaggctacagag
tgcatttacagcatgcagacagatgagcagagactagtcaacctcaaagagcaactaagg
aggaaaagtgaacatttgaaacagaagctggcacaactgcagaactcatgtttgagctca
aagcggcattga

DBGET integrated database retrieval system