KEGG   Salmo salar (Atlantic salmon): 100380347
Entry
100380347         CDS       T04363                                 

Gene name
pak3
Definition
(RefSeq) Serine/threonine-protein kinase PAK 3
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100380347 (pak3)
   04012 ErbB signaling pathway
    100380347 (pak3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100380347 (pak3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100380347 (pak3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100380347 (pak3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100380347 (pak3)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100380347 (pak3)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE20 family
   100380347 (pak3)
Membrane trafficking [BR:sasa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100380347 (pak3)
 Endocytosis
  Macropinocytosis
   Kinases
    100380347 (pak3)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100380347 (pak3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like APH Kdo DUF3402
Other DBs
NCBI-GeneID: 100380347
NCBI-ProteinID: NP_001167103
UniProt: C0H9V9
LinkDB
Position
ssa20
AA seq 550 aa
MSDNGDVEDKPPAPPMRNTSTLIGSCSKDPAPHGSKPLPPNPEDRKKKDRSIMSILTGGG
DKTNKKKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQA
VLDVLKFYDSKETNNSQKYMSFTDKSSDNYSCSNTSSSKAVSETPAIATVSEDEDEDEAT
PPPVVAPRPEHTKSIYTRSVIDPLPAPPTRDVATSPISPPPPEGATSAITPPTSPSPGPS
LPRPADKTRKKKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIATGQE
VAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGEELWVVMEYLAGGSLTDV
VTETCMDEAQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQIT
PEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYL
IATNGTPELQNPEKLSSVFRDFLNCCLEMDVEKRGSANDLLQHQFLKVAKPLSSLTPLIQ
AAKEAAKANR
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgtctgacaatggggatgtcgaggacaagcccccagccccgcccatgaggaacaccagc
actctgattggctcctgcagcaaagatcctgccccccatggctccaagccccttcccccc
aacccagaggacaggaagaagaaagatcgctccatcatgtccatcctgacaggaggagga
gacaagaccaacaagaagaaggagcgtccggagatctctctgccttctgattttgaacac
accatccacgtgggcttcgatgcggtcactggagagttcacaggcatgccggagcaatgg
gctcggttgctccagacctctaacatcactaagctggaacagaagaagaatcctcaggct
gtccttgacgttctcaagttctacgactccaaggagaccaacaacagccagaagtacatg
agttttacagacaagagttcagacaactacagctgttccaacacttctagctccaaggct
gtgtcagagacgcccgccatagcaaccgtatccgaggacgaggatgaagatgaggccacg
ccccctcctgttgtcgctccccgaccagaacacactaaatcaatatacactcgttctgtg
atagatcccctcccagcccctcccaccagagacgttgccacgtcacctatctccccccca
cctccggagggcgccacctccgccatcacgccccccactagcccctcccctggtccatca
ctgccacgccccgcagacaaaacacgcaagaagaagatgtctgatgaagagatactggag
aaactgcggagtatagtcagtgtgggagaccccaagaagaaatacacgcgtttcgagaag
atcggacagggtgcgtcaggtacggtatatacagccatagacatcgctacaggccaggag
gtggccattaaacagatgaacctgcagcagcagcccaagaaggagctcatcatcaacgag
atcctggtcatgagggaaaacaagaaccccaacatagtcaactacctggacagttacctg
gtgggggaggagttgtgggtggtgatggagtatctggctggaggttctctgactgacgtc
gtcacggaaacctgtatggatgaggctcagatcgctgctgtgtgtcgggagtgtctgcag
gccttggagttcctccattctaaccaggtgattcatcgtgacatcaagagtgacaacatc
cttctgggaatggacggatcagtgaaactcactgactttgggttctgtgcccagatcact
ccagagcagagtaagaggagcaccatggtggggactccctattggatggctccagaggtg
gtgaccaggaaggcttacggtcctaaagttgacatctggtctctaggcatcatggctata
gagatggtggagggagaacccccttacctcaacgagaacccactcagggcgttgtatctg
attgcgaccaacgggactccagaacttcagaacccagagaaactgtcctcggtcttcaga
gacttcctcaactgctgcctggagatggatgtggagaagagagggagcgctaacgaccta
ctacagcaccagttcctgaaggtggccaagcctttatccagtctgactcctctcatccag
gcagccaaagaagcagctaaggctaaccgctaa

KEGG   Salmo salar (Atlantic salmon): 106563430
Entry
106563430         CDS       T04363                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 3
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106563430
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106563430
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106563430
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106563430
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106563430
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE20 family
   106563430
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Spt5_N APH DSHCT DUF2052 CDC45 Kdo RXT2_N CENP-B_dimeris
Other DBs
NCBI-GeneID: 106563430
NCBI-ProteinID: XP_013984473
UniProt: A0A1S3L0N0
LinkDB
Position
ssa11
AA seq 573 aa
MSDRVDIEEKPPAPPLRMNSSSRDSTSVNHGSKPLPMAPEEKNKKVRLRSIFPGGDKTNK
KKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLD
VLKFYDSKETVNNQKYMSFTSGDKSAQGYIAANTLNRLLSSGPPVSLRTCSALFDKDAKT
STEPPIAPPVSEEEEEEEEEEEEEEDDDDDNELPPVIAPRPEHTKSIYTRSVIEPLAPPT
PVKEATTPPESQVQPENTSSTLYRHTDRQRKKSKMTDEEILERLRSIVSVGDPKKKYTRF
EKIGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDS
YLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSD
NILLGMDGSVKLTDFGFCAQITPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIM
AIEMVEGEPPYLNENPLRALYLIATNGTPELQNPERLTSVFRDFLNRCLEMDVDRRGSAK
ELLQHSFLKLAKPLSSLSPLIVAAKEAIKNSSR
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgtccgatagagtcgatattgaagagaaaccgccagcccctcccttgagaatgaacagt
agttcccgagactctacatcagtgaatcacggctccaaacctctcccaatggcccctgaa
gagaagaacaagaaggtccgccttcgctccatcttccctggaggagacaagacgaacaag
aagaaggagaaggagcgtcctgagatctccctgccctcagactttgagcacaccatccat
gttggctttgacgctgttacaggggagttcactggcatcccagagcagtgggcgcggctc
cttcagacctccaacataaccaagctggagcagaagaagaaccctcaggccgtgctggac
gtgctcaagttctacgactccaaagagacggtcaacaaccagaaatacatgagcttcacc
tccggagacaagtcagcacagggatacatagcagccaacactctgaaccgactgctgtcg
tctgggcctcctgtcagccttagaacctgcagtgcattatttgacaaggatgcaaagaca
tccacagagccccctatagcaccccctgtgtcagaggaggaggaggaggaggaagaggag
gaagaggaggaggaggatgacgatgatgacaatgagctgccacccgtcatcgcacctcga
cctgagcacactaaatctatctacacccgctctgtcatcgagcccttggcgcctcccacc
cctgtgaaggaggccacaaccccaccggagtctcaggtacagccggagaacacgtccagc
actctgtaccgccacaccgatcggcagaggaagaagtccaagatgacagacgaggagatt
ctggagcgactgaggagcattgtgagtgtgggggaccccaaaaagaagtacacacgcttt
gagaaaataggacaaggggcatctggcactgtgtacacagccattgacattgctactgga
caggaggtggccatcaagcagatgaacctccaacagcagcctaagaaggagctcatcatc
aacgagatcctggttatgagggaaaacaaaaaccccaacatagtcaactacctggacagt
tacctggtaggggatgagctatgggtggtgatggaatacctggctggaggttcactgact
gacgtggtgactgagacctgcatggacgagggccagatcgctgcagtctgcagagagtgt
ctgcaggctctggacttcctgcactccaaccaggtgatccacagagacatcaagagtgac
aacatcctgctgggcatggacggctcggtcaagctcaccgactttgggttctgtgcccag
atcaccccagagcagaacaagcgaagcaccatggtgggcacgccctattggatggcaccc
gaggtggtgacccgtaaggcctacgggcccaaggtggacatctggtccctgggtatcatg
gctatagagatggtggagggagaacctccctaccttaatgagaaccctctcagggccctg
tacctaatcgccaccaacgggactccagagctccagaaccctgagcgtctgacctccgtg
ttcagagacttcctcaaccgctgcctggagatggacgtggaccgcagaggctcagccaag
gagctactccagcattcattcctgaagttagccaagcccctgtccagcctgagccctctg
attgtagcagccaaggaggccataaaaaacagcagccgctag

KEGG   Salmo salar (Atlantic salmon): 106571135
Entry
106571135         CDS       T04363                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 6-like
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106571135
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106571135
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106571135
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106571135
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE20 family
   106571135
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo APH
Other DBs
NCBI-GeneID: 106571135
NCBI-ProteinID: XP_013999321
UniProt: A0A1S3M8N7
LinkDB
Position
ssa15
AA seq 674 aa
MFRRKKKRRPEISAPQDFEHRVHTSFDAVQGCFVGLPPQWQSVIDILRRPKPVVDPSRIT
NVELRPKKTICRGSFIGHGDYISHVISEMTRLTVTSSNSLRKSSPSARQRARSMGRLGDL
VEGDTYQYEELGQEKRHNGGNNYWQVQSESGSPKLALRKTSTLQPNGVLPRAKSTHEMST
AAGDKPAPLPKGPVPTPPRGGGTGHYTRSEWAGHINRPGQQMGMPQKGKVANQRPASCYN
LQTLQTQQQVNMRVKPGVSHLPDLLTSSKDTSPQRPHSSCDLKMNSLGPSAMSLPNGTSS
LIAGRGRTHRPSRSSSSYTIGLLSPIVQGATMPLLPKQDSPSQPRPSPTGSPATSSTGTA
QQQQPKPKLGPEPEPAKVTHEQFKAALQMVVDKGDPRTSLENFVKIGEGSTGVVCIARER
HSGRQVAVKMMDLRKQQRRELLFNEVVIMRDYRHNNVVEMYRSALVEEELWVIMEYLQGG
ALTNVVSETRLNEEQIATVCEAVLQALAYLHSQGVIHRDIKSDSILLTLDGRIKLSDFGF
CAQISKDIPKRKSLVGTPYWMAPEVVSKTPYGTQVDVWSLGIMVVEMVDGEPPYFSDTPV
AAMKKLRDEPPPTVRNTQKISPVLKDFLDRMLTRDPQERATASDLLEHPFLLQCGSRQCL
VPLVERYRKRMSRC
NT seq 2025 nt   +upstreamnt  +downstreamnt
atgttccggcggaaaaagaagcggaggccagagatctcggcaccacaggactttgagcat
cgggtccacacgtcattcgacgcagtgcaggggtgcttcgtgggcctgccgccccagtgg
cagagcgtcattgacatcctgaggaggccaaaaccggtggtggacccgtcccggatcacc
aatgtggagctcaggcccaagaagaccatttgtagggggagtttcattggacacggagac
tacatctcccacgtcatctccgagatgactcgtcttaccgtcaccagttccaactcgctt
cggaagagcagtccttcggcgcggcaacgggcacgctccatggggcgcctgggcgacctc
gtcgaaggggacacgtatcagtatgaggagctgggccaagagaagcgtcataacggcggt
aacaactactggcaggtacaaagcgagagcggcagccccaaactggctcttaggaaaacc
tccaccctccagcccaatggggtactgcctcgggcaaagtcgacgcatgagatgagcacg
gcggctggggataaacctgcacctctgccgaaggggccagtccccacgccccctagagga
ggaggcacaggtcattatacacgtagcgaatgggccggacatataaataggccgggacag
cagatggggatgccgcaaaagggcaaggtagccaatcagaggccggcatcctgctataac
ctgcagaccctgcagacgcagcagcaggtcaacatgagggtcaagcctggggtcagtcat
ctgccggaccttctgacctcctccaaggatacttctcctcagagaccccactcgtcctgt
gacctgaagatgaattcattagggccctcggccatgtccttacccaatggcaccagcagc
ctgatcgcaggccgagggcgaacccacagaccctcacgctcctcctccagctacaccatt
ggattgttatcacccatagttcagggggctaccatgcccctactccccaaacaggacagc
ccatcccagccccggccttctcccacgggctccccggccaccagctcaacaggaacggcc
cagcagcaacagcccaaacccaagcttgggccagagcccgagccggccaaagtgacccat
gaacagttcaaggcggccctgcagatggtggtggacaagggcgacccacgcacctccctg
gagaactttgtgaagatcggggagggctccacgggggttgtgtgcattgcccgcgagagg
catagtggtcggcaggtggcagtgaagatgatggatctccgtaagcagcagcgcagagag
ctgctctttaatgaggtggtgatcatgagggactaccggcacaacaatgttgtggagatg
tacaggagtgccctggtggaagaggagctgtgggttatcatggagtacctgcagggcggc
gctctaaccaacgttgtgtctgaaaccaggctgaatgaagagcagatagccaccgtgtgc
gaggctgtactacaggcattagcctatctccattcccagggagttatccaccgtgacatc
aagagtgactctatactgctcacgctggatgggaggatcaagctgtcagactttggattc
tgtgctcagatcagcaaagacatccccaaaaggaagtccttggttggaacaccgtactgg
atggctccagaggttgtgtcaaagacgccatatggaactcaggtggatgtgtggtccctg
ggtatcatggtggtagagatggtggatggagagcctccgtacttcagtgacacgccagtg
gcagctatgaagaaactgagggacgagccgccacccacagtcaggaacacacagaagatc
tcccctgtgctgaaggacttcctggatcgtatgctaacacgggacccccaggagcgggct
accgctagcgacctgctggagcaccccttcctgctgcagtgtggctcgcggcagtgcctg
gtgcccctagtagaacgataccgtaagcgcatgtcccgctgctga

KEGG   Salmo salar (Atlantic salmon): 106571559
Entry
106571559         CDS       T04363                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 7-like
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106571559
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106571559
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106571559
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106571559
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE20 family
   106571559
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 106571559
NCBI-ProteinID: XP_014000206
UniProt: A0A1S3MB70
LinkDB
Position
ssa15
AA seq 821 aa
MQGSHNSFLPVLVRNMAKIRPRFICGAELTFTGEVSPGLSGFSSMFGKKKKRLEISAPSN
FEHRVHTGFDEREQKFTGLPQQWQSLLADTANRPKPMVDPSYITPIQLAPMKISPKKIRS
AETPLRKTIVRGNRPPKDTSINGLLEEFDSISVTRSNSLRKESPTGPHQAGSGAPKPPSH
HPPHPHPNAPEENGFSHYYSRYSCDLDTSSRDFSLEPYGKDGKGFALDGDWAVGRHYRFP
KQNGHLTHATRVPFYPDAMPQKTDYAKLPPDYHTYLESKVAGARLADEVGSGSGVGSAGG
SAGSTTGGYYRASVGGSSSQDYRDASMVGTPSRASLHSEQINYPDSEWSYSGMSRDEYEK
RPKSSYVMQTSPTPAIRQRSRSGSGLQEPNVPYGASGAFKSPPQTHPYSSYTYPRLSETL
TNSQAMAKGDYDQSSWDGSPQVPGSDTYPRGPLKLPQSHSKPSGYPPGLQYPPVFHHYKP
SPYHHPPSQPSPPYTPQGAYSQPSSPYIPPGAYPPPSWGSSSDAQPSRVSHEQFRAALQL
VVNPGDPREYLESFIKIGEGSTGIVCIASEKHSGKQVAVKKMDLRKQQRRELLFNEVVIM
RDYHHENVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIATVCVSVLRALSY
LHTQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKRKSLVGTPYWMAPEVISRL
PYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDNLPPRIKESHKVSSVMRAFLD
LMLVREPSQRATAQELLQHPFLKLSGPPSCIVPLMRHYRHR
NT seq 2466 nt   +upstreamnt  +downstreamnt
atgcaaggctctcataactcctttttaccagttctggtaagaaacatggctaagatacga
ccacgatttatctgtggagcagagctcacttttacaggggaggtcagtccaggtttgtcc
gggttttccagcatgtttgggaaaaagaagaagaggctagagatttcagctccgtctaac
tttgagcaccgggtccacactggtttcgacgagcgggagcagaagttcacaggtctgccc
cagcaatggcagagtctcctggcagacacagccaacagacccaagcccatggtagacccc
tcctatatcacacccatacagctggctcctatgaagatatctcccaagaaaatccggtcg
gccgaaacaccgttgcgaaaaaccatcgttcgagggaaccggcccccgaaggacacgtcc
atcaatggtctcctagaggagttcgacagcatctctgtgacacgttccaactccctgcgt
aaagagagccctacgggcccccaccaggccgggtccggggcccccaaaccaccctcccac
caccctccacacccccaccccaacgcccctgaggagaacggcttcagccactactactcc
cgctactcctgtgacctggacacctccagtagggacttctctctggagccctacgggaag
gacggtaaaggcttcgctctggatggggactgggccgtggggagacactaccgctttccc
aaacagaatggccacctcacccacgccacccgtgttcccttctaccccgacgccatgcct
cagaagaccgattatgccaagctgcctccggactaccacacctacctggagagcaaggtg
gcgggggcgcgcttggccgacgaggtgggatctgggtccggggtgggcagcgcagggggg
tctgccgggtccacgacaggggggtactaccgggcgtccgtaggcggttcgtccagtcag
gactaccgggatgcgtcgatggtggggacaccgtcgcgagcctcactgcacagcgagcaa
atcaactacccggacagcgagtggagctacagcggcatgtccagagacgagtacgagaaa
aggcccaagtcgtcgtacgtgatgcagaccagccccacgccggccatcagacagcgctca
aggtcggggtccggcctccaggagcccaacgtgccctacggggccagcggggcctttaag
agtccccctcagacacacccctacagctcctacacctacccacgcctttcagagactctc
accaactcacaggccatggccaagggtgattacgaccagtcgtcttgggacgggagtccc
caggtcccagggtctgacacatacccccgtgggcccctcaaactacctcaaagccacagc
aagccctctggctacccccccggactccagtatccccctgtgttccaccactacaaaccc
tccccctaccaccacccaccctcacagcccagcccgccatacactccacagggggcatac
tcccagccatcgtccccctacatcccaccgggggcctacccccctccctcctggggctcc
agttcagatgcccagccctccagggtctcccacgaacagttcagggctgccttgcagctc
gtcgtcaacccaggcgaccccagggagtacctggagagtttcataaagattggcgagggc
tcgacgggcatcgtgtgcattgccagcgagaagcatagtggcaagcaggtggccgtcaag
aagatggacttgaggaaacagcagaggagagaactgctcttcaatgaggtggtgatcatg
agggactatcaccacgagaacgtggttgatatgtacaacagctacctggttggagacgag
ctctgggtcgttatggagttcctggagggcggggccctgacggacattgtcactcacacg
aggatgaacgaggagcagatagccacagtgtgtgtgtcggtgttgagggctctgtcgtac
ctccacacgcagggagtcatccacagagacatcaagagtgattctatcctcctcaccagc
gatggacggatcaagctgtcagactttggcttctgcgcccaagtgtccaaagaggtgccc
aagaggaagtctctggtgggcacaccctactggatggcaccagaggtcatctcacggtta
ccctacggcacggaggtggatatctggtcgttgggcatcatggtgatagagatgatagat
ggggaacccccgtactttaacgaacctcctctacaggccatgaggaggatacgagacaac
ctgcctccacggataaaggagtcacacaaggtatcatcggttatgagggccttcctcgac
ctgatgttggttcgagagccgtctcagcgagccacagcccaggagctgctccagcacccc
ttcctcaagctctcgggccccccatcttgcatcgtccccctaatgaggcactaccgccac
cgctga

KEGG   Salmo salar (Atlantic salmon): 106580861
Entry
106580861         CDS       T04363                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 4-like
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106580861
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106580861
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106580861
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106580861
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE20 family
   106580861
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 106580861
NCBI-ProteinID: XP_014017829
UniProt: A0A1S3NQZ7
LinkDB
Position
ssa20
AA seq 655 aa
MFTKKKKPRVQISAPSNFEHRVHTDFDEQEQKFVGLPRQWQSLIEDTAKRPKPFIDVTVI
TTVEPRKTIVRGSKIAVDGSLTWLLDEFDTMSVTRSNSLRRGSPPIQPRRDSGSSGGGGH
ENGNLTHRPHHHPDHYGDRDRERPRPDQLAGGDPRQPQREPRSQREDGRPQQQPRGQEPG
SRHRERERPCPPPPPPKPRDMDPRDQVVRRDGPSDKRPKSSYTGRDGSPQSPRDKRPLSG
PNIRMPNLPVTEGVIKTAQQSSRPFNTYPRTDSEGGRSPTSQELKPARPHETPCHNGPSS
GRSGGKAPQQGQLRGDPHHTSHPVLGPEPPHGYQQLKAPVPRPPAPTLPPQQALSPQREP
QRVSHEQFRAALQMVVDPGDPRTYLDHYIKIGEGSTGIVCIATVKSTGKLVAVKKMDLRK
QQRRELLFNEVVIMRDYHHDNVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQ
IATVCLSVLKALSVLHTQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVQRRKSLV
GTPYWMAPELISRLPYGPEVDIWSLGVMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPKLK
NLHKVSPLLKGFLDKLLVRDPTQRASANELLKHPFLSKAGPPSCIVPLMRQNRMR
NT seq 1968 nt   +upstreamnt  +downstreamnt
atgttcaccaagaagaagaagcctcgcgtccagatttcggcgccttccaacttcgagcac
cgcgtgcacacagactttgacgagcaggaacagaagtttgtggggctgccgcggcaatgg
cagtctctgatcgaggacacggccaagaggcccaagcccttcatcgacgtcaccgtcatc
accacggtggagccccgcaagaccatagtgcggggtagtaagatcgctgtggacggctcg
ctgacatggctgctggatgagtttgacaccatgtcggtgacccgctccaactccctgagg
cgaggcagcccccctatccagccccgcagagactccggatcctcggggggaggaggccat
gagaacgggaacctgacccaccggccacaccaccacccagatcactatggagacagagat
agggagcggcccaggccggaccagttagctggtggagacccccggcagccccaacgggaa
ccccgctctcagcgagaggacggccggccacagcagcagccccggggccaggagccaggc
agcaggcaccgagagagggagcggccctgcccacctcctcccccgccaaagcccagagac
atggacccacgggaccaggtagtccgcagggacgggcccagcgacaagaggcccaagtcc
agctacacaggcagggacggcagcccccaatcgccccgggataagaggcctctctcgggg
cccaacatccgtatgcctaacctccctgtcacagagggggtgataaaaacagcacagcag
agcagcaggccattcaacacctacccccgcactgacagtgaaggaggaaggagccccacc
agccaggagctgaagccagcccgaccacacgaaacaccgtgccacaacggtccctctagt
ggccgcagcgggggcaaagccccacagcagggccagctacgaggggacccccaccacacc
tcccaccctgtcctgggccctgagcccccccacggctaccagcagttgaaggctcctgtt
ccccgcccccctgcccctaccctaccaccacagcaggccctctcgccccagagggagccc
cagcgggtgtcccatgagcagttccgcgccgcactgcagatggtggtggacccgggtgac
ccgcgcacctacctggatcactacatcaagatcggagagggctccaccggcattgtgtgc
attgccaccgtcaagagcactggcaaactggtggctgtcaagaagatggacctgcgcaag
cagcagcgccgggagctgctattcaatgaggtggtgataatgcgggactatcaccatgac
aacgtggtggagatgtacaacagctacctggtgggagatgaactctgggtcgtcatggaa
ttcctggagggaggggctttgactgacatcgtcacacacaccaggatgaatgaggagcag
atagccacagtgtgcctgtctgtgctgaaggctctgtcagtgctgcacacccagggcgtc
atccacagggacatcaagagtgactccatccttctcacccacgatggcagagtgaaactg
tcagactttggcttctgcgcccaggtgtctaaagaggtccagcggcgcaagtccctggta
ggcacaccctactggatggccccagagctcatctcacgactaccctatgggcctgaggtg
gacatctggtccttgggggtgatggtgatcgagatggtggacggagaacccccctatttc
aatgagccccccctcaaagctatgaagatgatccgtgacaacctaccacccaaactcaag
aacttacacaaggtttctcctctcctcaagggcttcctggacaaattgctggtgcgagac
cctacccagagggcctcagccaatgagctgctcaagcaccccttcctgagcaaggctggc
cctccctcctgcatcgtgcctctcatgaggcagaaccgcatgagatga

KEGG   Salmo salar (Atlantic salmon): 106581963
Entry
106581963         CDS       T04363                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 6-like
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106581963
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106581963
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106581963
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106581963
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE20 family
   106581963
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 106581963
NCBI-ProteinID: XP_014020065
UniProt: A0A1S3NXR4
LinkDB
Position
ssa01
AA seq 675 aa
MFRKKKKKRPEISTPKNFEHRVHTSFDAKRCCFVGLPTQWHSLIENLRRPKPMVDPSRIT
SVELKPKKTIVRGSMIGHGDYISTMISDMSRLSVTSSNSLSKSSPSARKRAQSLGRLGEV
KEGDTYQYENLGEDELEQHQWRDRAHNIHSESGTSITLQPNGVLPRAKSTYEVSISSLEG
PLAPSQPMQVPIKGAYISCKVGSPTETLMVKRDFQVPRVMPQKQRPISFFYSPAMAVQHT
DHGDHPPPEYSTNLYIHSHNSPGSYDLKAESALRHHQSGFLPSTTSSPFMSGIRPHRTVR
SSASYTLGLSPNMGLRPNGPDPFLRHSGCPNAPFPGQDSPSQPRPSPTGSLATSPPGTCS
PAFRPPQHPQRPPPDPPKVTHKQFKAALNMVVDKGDPRSYLENFVKIGEGSTGVVCIARE
KHSGRQVAVKMMDLRRQQRRELLFNEVVIMRDYQHRNVVEMFKSALVEEELWVIMEYLQG
GALTNIVSETRLSEEQIATVCEAVLQALAYLHSQGVIHRDIKSDSILLTLDGRIKLSDFG
FCAQISKDIPKRKSLVGTPYWMAPEVISKSPYSTEVDVWSLGIMVVEMVDGEPPYFSETP
VAAMRRLRDEPAPTVRNATEVSPVLKDFLDRMLIRDPVERASATDLLEHPFLLQSGSSQC
LVPLVEQYRKRMSRC
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgtttcgtaagaagaaaaagaagaggccagagatctcaacaccaaagaactttgagcac
cgggtgcacacctcgtttgacgccaagcggtgctgctttgtgggcctgccaacccaatgg
cacagtctgatagagaacctccgtaggcccaagcctatggtggacccctcccggatcacc
tccgtggagctcaagccaaagaagaccatcgtgcgtgggagtatgatcggtcatggagac
tacatctcaaccatgatctccgacatgagcaggttgtccgtgaccagctccaactccctg
agtaagagcagcccttcagctaggaaaagggcccagtccctgggcaggctgggggaggtg
aaggagggggacacctaccagtacgaaaacctgggagaagatgagctggagcagcatcag
tggagagacagggctcataacatccacagtgagagtgggacgagtatcaccctacagccg
aacggagttctccccagggccaagtccacctatgaagtgagcatcagctctctggaggga
cccctggctccatcccagccaatgcaggtgcctattaagggggcttatatcagctgtaag
gtgggtagccccacagagacactgatggttaagagagacttccaggtgcccagggttatg
ccacaaaaacagaggcccatctcgttcttctacagcccagccatggctgtccagcatacc
gaccatggggatcacccccctccggagtacagcaccaacctctacatccactcccacaac
agccctggctcctacgacctgaaggcagagtcggctctcaggcaccaccagtcaggcttc
ctacccagcaccaccagtagtcccttcatgagtggcatcagaccccacaggacggtacgc
tcctcagccagctacaccctgggactgtctcccaacatgggcctgagacccaacggccct
gacccctttctgagacactcaggctgccctaatgctcccttccccgggcaggacagccct
tcccagccccggccttcccccaccggctccctggccaccagccccccgggcacatgttcc
cctgccttcagaccccctcagcacccacagaggccaccaccagacccccccaaggtgacc
cataaacagtttaaggctgccctgaacatggtggtggacaagggagaccctcggtcgtac
ctggagaactttgtgaagattggagaagggtccacaggggtggtgtgtatcgctcgggag
aaacacagcggcaggcaggtggccgtgaagatgatggacctgcggagacaacaacgtagg
gagctgcttttcaacgaggtggtgatcatgagggactaccagcacaggaacgtggtggag
atgtttaagagtgccctggtggaggaggagctctgggtcattatggagtacctacagggt
ggagcactaaccaacatcgtgtctgaaaccaggctgagtgaggagcagatagccacagtc
tgtgaggctgtgctgcaagccctggcctaccttcactcccagggggttatccacagggac
atcaagagtgactccatactgctaacactggatgggaggatcaagctgtccgactttggg
ttctgtgctcagatcagtaaagacatccccaaaaggaagtctttagtgggaacaccctac
tggatggctccggaggtcatctctaaatcaccatacagcactgaggtagatgtgtggtct
ctgggtatcatggtagttgagatggtggatggagagcccccctacttcagtgagacccct
gttgcagccatgagaagactgagggatgagccagctcccactgtacggaacgcaacagag
gtctccccggtgttgaaggacttcctggaccgtatgttgatccgagacccagtggagcgg
gccagcgccacagacctgctagaacaccccttcctcctacagagcggctcctcgcagtgc
ctggtgcccctggtggaacagtaccgcaagcgcatgtcccgctgctga

KEGG   Salmo salar (Atlantic salmon): 106584354
Entry
106584354         CDS       T04363                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 2-like
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106584354
   04012 ErbB signaling pathway
    106584354
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106584354
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106584354
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106584354
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE20 family
   106584354
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH Kdo zinc-ribbons_6 Haspin_kinase
Other DBs
NCBI-GeneID: 106584354
NCBI-ProteinID: XP_014025043
UniProt: A0A1S3PBN2
LinkDB
Position
ssa23
AA seq 531 aa
MCDNGDPEDKPPAPPVRMSSTIFSTGSSKDPLSANHSSKPLPSVPEERKPRNKIISIFSG
AEKGGRKKDRDKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQK
KNPQAVLDVLKFYDSTGNGRQKYLSFSSEKDGFPAGPHSLVKKGTEPSSISIKDIDDDDD
DDDETPPPIVAPRPEYTKSVYTRSVIDPIPAPATCPDGDAASKALDRQKKKGKMSDEEIM
DKLRTIVSIGDPRKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIIN
EIMVMKELKNPNIVNYVDSFLVGEELYVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECL
QALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPE
VVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIF
RDFLNLCLEMDVEKRGGGKELLQHPFLKLAKPLSSLTPLILAAKEAMKGNR
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgtgtgataacggggatcccgaggacaagcccccggcccccccagtcaggatgagcagc
accatcttcagcacaggctccagcaaggacccgctctcagccaatcacagctccaagccc
ctgccctcggttccagaagaaaggaaaccccgcaacaagataatctcaattttctcagga
gcagagaaaggtggtagaaagaaagaccgggacaaagaacgaccagagatctctccgcct
tcagactttgaacacaccatccacgttggctttgatgctgtcactggggagttcactggc
atgccagagcaatgggcacggctcctccagacgtcaaacatcaccaaatcagagcagaag
aagaacccacaggctgttctcgacgtgctcaaattctatgattcaacgggcaacggccgc
cagaaatacctcagtttctcctctgaaaaggatggtttccctgcagggccccactctctg
gtcaaaaagggcacagaaccctcatcgatcagtatcaaggacattgatgatgatgatgat
gatgatgatgaaactcccccacccattgtggcaccacgtccagaatacactaagagtgtt
tacactcgctccgtcattgaccccatccctgctccagccacgtgtccagatggagacgca
gcctccaaggcgctagacagacagaagaagaagggcaagatgtcagacgaggagatcatg
gacaaactgagaactattgtcagcattggagatcccagaaagaagtacacaagatatgaa
aaaattggacagggggcttcagggacagtgttcacagccattgacgtcgccaccggacag
gaggtggccattaaacagatcaacctacagaagcagcccaagaaggagctgatcatcaat
gagattatggtgatgaaagagttaaagaatccgaacattgtcaactatgtagacagtttc
ctggtgggagaggagctctatgtggtgatggagtatttggctggtggttcgctgactgat
gtggtgacagagacctgcatggacgaggctcagatagctgctgtttgcagagagtgttta
caagcactggagttccttcatgcgaaccaggtcatccatcgtgacatcaagagtgacaac
gtgctactgggaatggatggctctgtcaagctcaccgattttggtttctgcgcccagatc
actccagagcagagcaagcgcagcaccatggtgggtacgccttactggatggcacctgag
gtggtgacccggaaagcctatgggcctaaggttgatatctggtccctgggcatcatggcc
attgagatggttgagggggagcctccatacctcaatgagaacccgctaagagcactgtac
ctgattgccacaaatgggactccagaactgcagaacccagagaaactgtctcccatattc
agagacttccttaacctctgcctggaaatggatgtggagaagagaggtgggggcaaagag
ctgctgcagcatcccttcctgaagctggcaaaacccctctccagtcttacacctctaatc
ttggctgctaaggaggccatgaaaggcaaccgttaa

KEGG   Salmo salar (Atlantic salmon): 106594148
Entry
106594148         CDS       T04363                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 2-like
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106594148
   04012 ErbB signaling pathway
    106594148
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106594148
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106594148
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106594148
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE20 family
   106594148
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like APH Kdo zinc-ribbons_6 CENP-B_dimeris
Other DBs
NCBI-GeneID: 106594148
NCBI-ProteinID: XP_014040988
UniProt: A0A1S3QLP3
LinkDB
Position
Un
AA seq 518 aa
MCDSGVCEDKPPAPPVRMNSQGGGAKDSVSGTYNSRSLPSVPEEKHKRNKIISMFASEKG
GRKKDRDKDNRPEISSPSDFEHTIHVGFDAVTGEFTGMPEQWSNLLQTSNISKSEQKQNP
QAVLDILKFYDSSTAKQKYLSFSEKDAQSPGKQGATSSPSGGKDGDDDDDEDGDEAPPPI
VAPRPEHTKSVYTKSVIDPLPPLPEPDSASNRNKKKQQGKMTDEEIMEKLRTIVSIGDPK
KKYTRYEKIGQGASGTVYTAIDVATGAEVAIKQINLQKQPKKELIINEILVMKELQQPNI
VNYVDSFLVGEELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIH
RDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDI
WSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQSPEKLSPVFRSFLSRCLEMDVE
KRGGGKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgtgtgacagcggtgtgtgtgaagacaagccccccgccccgcctgtcagaatgaacagc
caaggaggcggagccaaggactctgtgtcgggaacctacaactctcggtccctcccctct
gttcctgaggagaaacacaaacgaaataaaatcatctccatgttcgcctcagagaaagga
ggcaggaagaaggatcgggataaggacaacagaccagagatctcctctccgtcagacttt
gaacacaccatccatgttggcttcgatgccgtcacaggagagttcacaggcatgccagag
cagtggtccaacctgctccagacgtctaacatcagtaaatcagagcagaagcagaatcct
caggctgttctagacattctcaagttctacgactcctccaccgcaaaacagaaatacctc
tccttctcagaaaaagatgcacagtcgcctggaaagcagggtgccacgtcctcgccatca
ggcggtaaagacggtgatgatgatgacgatgaggatggagacgaagctccgccccctatt
gtggcgccacggcctgagcacaccaaatcagtgtacaccaagtctgtcatcgacccactt
cccccgctgccagagcctgactccgcctccaacaggaacaagaagaaacagcagggcaag
atgactgacgaggaaatcatggagaaactacgaaccatcgtcagtattggagatcccaag
aagaagtacacacgctatgagaagatcggccagggagcgtctggtactgtctacacagcc
atcgatgttgccactggtgcagaggtagctatcaaacagatcaacctccagaaacagccg
aagaaggagctgatcatcaacgagatcctggtgatgaaggagttacagcaacctaacatc
gtcaactacgtagacagtttcctggtaggtgaggagttgtttgtggtgatggagtatctg
gccggaggttcgctaacggacgttgtcacggaaacatgcatggacgaggctcagatcgct
gctgtgtgcagagagtgtctgcaggctctggagttcctccatgccaaccaggtgatccac
agagacatcaagagtgacaacgttctgctgggaatggacggatctgtcaagctcactgac
tttgggttctgtgcccagatcactccagagcagagtaagaggagcaccatggtggggact
ccctactggatggctcctgaggtggtgaccaggaaggcctacggacccaaggtggacatc
tggtccctgggcatcatggctatagagatggtggagggagagcccccttacctcaacgag
aacccactcagggccctctacctgatagccaccaatgggactccagagctccagtctcca
gagaagttatctccagtgttcaggtccttcctgtcccgctgtctggagatggatgtagag
aagagaggaggggggaaagaactactgcagcatccattcctaaagctggccaagcctctc
tccagcctcacccctctcatcctggcagccaaggaggccatgaagagtaaccgctaa

KEGG   Salmo salar (Atlantic salmon): 106595470
Entry
106595470         CDS       T04363                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 2-like
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106595470
   04012 ErbB signaling pathway
    106595470
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106595470
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106595470
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106595470
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE20 family
   106595470
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like APH Kdo zinc-ribbons_6 CENP-B_dimeris
Other DBs
NCBI-GeneID: 106595470
NCBI-ProteinID: XP_014042318
UniProt: A0A1S3QLP3
LinkDB
Position
Un
AA seq 518 aa
MCDSGVCEDKPPAPPVRMNSQGGGAKDSVSGTYNSRSLPSVPEEKHKRNKIISMFASEKG
GRKKDRDKDNRPEISSPSDFEHTIHVGFDAVTGEFTGMPEQWSNLLQTSNISKSEQKQNP
QAVLDILKFYDSSTAKQKYLSFSEKDAQSPGKQGATSSPSGGKDGDDDDDEDGDEAPPPI
VAPRPEHTKSVYTKSVIDPLPPLPEPDSASNRNKKKQQGKMTDEEIMEKLRTIVSIGDPK
KKYTRYEKIGQGASGTVYTAIDVATGAEVAIKQINLQKQPKKELIINEILVMKELQQPNI
VNYVDSFLVGEELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIH
RDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDI
WSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQSPEKLSPVFRSFLSRCLEMDVE
KRGGGKELLQHPFLKLAKPLSSLTPLILAAKEAMKSNR
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgtgtgacagcggtgtgtgtgaagacaagccccccgccccgcctgtcagaatgaacagc
caaggaggcggagccaaggactctgtgtcgggaacctacaactctcggtccctcccctct
gttcctgaggagaaacacaaacgaaataaaatcatctccatgttcgcctcagagaaagga
ggcaggaagaaggatcgggataaggacaacagaccagagatctcctctccgtcagacttt
gaacacaccatccatgttggcttcgatgccgtcacaggagagttcacaggcatgccagag
cagtggtccaacctgctccagacgtctaacatcagtaaatcagagcagaagcagaatcct
caggctgttctagacattctcaagttctacgactcctccaccgcaaaacagaaatacctc
tccttctcagaaaaagatgcacagtcgcctggaaagcagggtgccacgtcctcgccatca
ggcggtaaagacggtgatgatgatgacgatgaggatggagacgaagctccgccccctatt
gtggcgccacggcctgagcacaccaaatcagtgtacaccaagtctgtcatcgacccactt
cccccgctgccagagcctgactccgcctccaacaggaacaagaagaaacagcagggcaag
atgactgacgaggaaatcatggagaaactacgaaccatcgtcagtattggagatcccaag
aagaagtacacacgctatgagaagatcggccagggagcgtctggtactgtctacacagcc
atcgatgttgccactggtgcagaggtagctatcaaacagatcaacctccagaaacagccg
aagaaggagctgatcatcaacgagatcctggtgatgaaggagttacagcaacctaacatc
gtcaactacgtagacagtttcctggtaggtgaggagttgtttgtggtgatggagtatctg
gctggaggttcgctaacggacgttgtcacggaaacatgcatggacgaggctcagatcgct
gctgtgtgcagagagtgtctgcaggctctggagttcctccatgccaaccaggtgatccac
agagacatcaagagtgacaacgttctgctgggaatggacggatctgtcaagctcactgac
tttgggttctgtgcccagatcactccagagcagagtaagaggagcaccatggtggggact
ccctactggatggctcctgaggtggtgaccaggaaggcctacggacccaaggtggacatc
tggtccctgggcatcatggctatagagatggtggagggagagcccccttacctcaacgag
aacccactcagggccctctacctgatagccaccaatgggactccagagctccagtctcca
gagaagttatctccagtgttcaggtccttcctgtcccgctgtctggagatggatgtagag
aagagaggaggggggaaagaactactgcagcatccattcctaaagctggccaagcctctc
tccagcctcacccctctcatcctggcagccaaggaggccatgaagagtaaccgctaa

KEGG   Salmo salar (Atlantic salmon): 106595887
Entry
106595887         CDS       T04363                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106595887
   04012 ErbB signaling pathway
    106595887
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106595887
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106595887
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106595887
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE20 family
   106595887
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal APH Kinase-like Kdo zinc-ribbons_6
Other DBs
NCBI-GeneID: 106595887
NCBI-ProteinID: XP_014042706
UniProt: A0A1S3QRU5
LinkDB
Position
Un
AA seq 265 aa
MPEQWSNLLQTSNISKSEQKQNPQAVLDILKFYDSSSAKQKYLSFSEKDAHVSFLVGEEL
FVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMD
GSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEG
EPPYLNENPLRALYLIATNGTPELQSPEKLSPVFRSFLSRCLEMDVEKRGGGKELLQHPF
LKLAKPLSSLTPLILAAKEAMKSNR
NT seq 798 nt   +upstreamnt  +downstreamnt
atgccagagcagtggtccaacctgctccagacgtctaacatcagtaaatcagagcagaag
cagaatcctcaggctgttctagacattctcaagttctacgactcctcctccgcaaaacag
aaatacctctccttctcagaaaaagatgcacatgttagtttcctggtaggtgaggagttg
tttgtggtgatggagtatctggccggaggttcgctaacggacgttgtcacggaaacatgc
atggacgaggctcagatcgctgctgtgtgcagagagtgtctgcaggctctggagttcctc
catgccaaccaggtgatccacagagacatcaagagtgacaacgttctgctgggaatggac
ggatctgtcaagctcactgactttgggttctgtgcccagatcactccagagcagagtaag
aggagcaccatggtggggactccctactggatggctcctgaggtggtgaccaggaaggcc
tacggacccaaggtggacatctggtccctgggcatcatggctatagagatggtggaggga
gagcccccttacctcaacgagaacccactcagggccctctacctgatagccaccaatggg
actccagagctccagtctccagagaagttatctccagtgttcaggtccttcctgtcccgc
tgtctggagatggatgtagagaagagaggaggggggaaagaactactgcagcatccattc
ctaaagctggccaagcctctctccagcctcacccctctcatcctggcagccaaggaggcc
atgaagagtaaccgctaa

KEGG   Salmo salar (Atlantic salmon): 106603108
Entry
106603108         CDS       T04363                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 3-like
  KO
K05733  p21-activated kinase 3 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106603108
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106603108
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106603108
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106603108
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106603108
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE20 family
   106603108
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Spt5_N APH DSHCT DUF2052 Kdo CENP-B_dimeris
Other DBs
NCBI-GeneID: 106603108
NCBI-ProteinID: XP_014051812
UniProt: A0A1S3RIZ8
LinkDB
Position
ssa04
AA seq 571 aa
MSDSVDIEEKPPAPPLRMNSSSRDSSSVNHGSKPLPMAPEEKNKKVRLRSIFPGGDKTNK
KKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWARLLQTSNITKLEQKKNPQAVLD
VLKFYDSKETVNNQKYMSFTSGDKSAHGYIAVNTLNRLLSSGPPVSHRTCSALFDKGAKT
STEPPIAPPVSEEEEEEEEEEEEDDDDDNELPPVIAPRPEHTKSIYTRSVIEPLAPPAPV
KEVTTPPESQVQPENTSSTLYRNTDRQKKKSKMTDEEILERLRSIVSVGDPKKKYTRFEK
IGQGASGTVYTAIDIATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYL
VGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALDFLHSNQVIHRDIKSDNI
LLGMDGSVKLTDFGFCAQITPEQNKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAI
EMVEGEPPYLNENPLRALYLIATNGTPELQNPERLTSVFRDFLNRCLEMDVDRRGSAKEL
LQHSFLKLAKPLSSLSPLIVAAKEAIKNSSR
NT seq 1716 nt   +upstreamnt  +downstreamnt
atgtccgatagtgtcgatattgaagagaaaccgccagcccctcccttgagaatgaacagt
agttcccgagactcttcatcagtgaatcacggctccaaacctctcccaatggctcctgaa
gagaagaacaagaaggttcgcctgcgctccatcttccctggaggagacaagacaaacaag
aagaaggagaaggagcgtcctgagatctccctgccttcagactttgagcacaccatacat
gttggttttgacgctgttacaggggagttcactggcatcccagagcagtgggcgcgcctc
cttcagacctccaacatcaccaagctggagcagaagaagaaccctcaggccgtgctggac
gtgctcaagttctacgactccaaagagacggtcaacaaccagaaatacatgagtttcacc
tccggagacaaatccgcgcatggatacatagcagtcaacactctgaaccgactgctgtcg
tctgggcctcctgtcagccatagaacctgcagcgcattatttgacaagggtgcaaagaca
tccacagaacccccgattgcgccccctgtgtcagaggaagaggaggaggaggaggaagaa
gaggaggaggatgacgatgatgacaatgagcttccacccgtcatcgcacctcgacctgag
cacactaaatctatatacacccgctctgtcatcgagcccttggcgcctcccgcccctgtg
aaggaggtcacaaccccaccggagtcccaggtccagccagagaacacgtccagcactctg
taccgcaacaccgaccggcagaagaagaagtccaagatgacagacgaggagattctggag
cgactgaggagcattgtgagtgtgggggaccctaaaaagaagtacacacgctttgagaaa
ataggacaaggggcatctggcactgtatacacagccattgacattgctactggccaggag
gtggccatcaagcagatgaatctccagcagcagcccaagaaggagctcatcatcaatgag
atcctggtgatgagggaaaacaaaaaccccaacatagtcaactacctggacagttacctg
gtaggggatgagctgtgggtggtgatggagtacctggctggaggctcactgactgatgtc
gtgactgagacctgcatggacgagggccagatcgctgcagtctgcagagagtgtctgcag
gctctggacttcctgcactccaaccaggtgattcacagagacatcaagagtgacaacatc
ctgctgggcatggacggctcggtcaagctcactgacttcgggttctgtgcccagatcacc
ccagaacagaacaagcgcagcaccatggtgggcacgccctactggatggcacccgaggtg
gtgacccgcaaggcctacgggcccaaggtggacatctggtccctgggtatcatggccata
gagatggtggagggagaacctccctacctgaatgagaaccctctcagggcactgtacctt
atcgccaccaacgggactccagagctccagaaccctgagcgattgacctccgtgttcaga
gacttcctcaaccgttgcctggagatggacgtggaccgcagaggctcagccaaggagctc
ctccagcattcgttcctgaagttagccaagcccctgtccagcctgagccctctgattgtt
gcagccaaggaagccatcaagaacagcagtcgttag

KEGG   Salmo salar (Atlantic salmon): 106608064
Entry
106608064         CDS       T04363                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 7-like
  KO
K05736  p21-activated kinase 5 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106608064
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106608064
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106608064
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106608064
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE20 family
   106608064
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 106608064
NCBI-ProteinID: XP_014061219
UniProt: A0A1S3SA50
LinkDB
Position
ssa06
AA seq 720 aa
NGTSHSIIFLWCPPCSYSKLTVCLLSVPQTIVRGNRPPKEASINGLLEEFDNISVTRSNS
LRKESPTGSHQAGAPKPASHHPQHPHPNEENGFSHYYSRYSCDLDTPSRDFSLEPYRKDG
KGFAPDGDWAVGRHYRFPKQNGHLTHATRIPFYPDAMPQKADYAKLPPDYHTYLESKVAG
ARSADEVGSGSGVGSGGGSAGSTTGGYYRASVGGSSSQDYRDASMVGTPSRTSLHSEQIN
YPDSEWSYSGVSRDEYEKRPKSSYVRQNSPTPAIRQRSRSGSGLQEPNVPYRASGVFKSP
PQTHPYSSYTYPRLSETLTNSQAMAKGDYDQQSRDGSPQVPGSDTYPRGPLKLPQSHNKP
SGYPPGHLQYPAVFHHYKPSPYHHPPSQPSPPYTPQGAYSQPSSLYIPLGAYPPPSWGSS
SDAQPSRVSHEQFRAALQLVVNPGDPREYLDSFIKIGEGSTGIVCIASEKHSGKQVAVKK
MDLRKQQRRELLFNEVVIMRDYHHENVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTR
MNEEQIATVCVLVLRALSYLHIQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPK
RKSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDNL
PPRIKESHKVSSVLRAFLDLMLVREPSQRATAQELLQHPFLKLSGPPSCIVPLMRHYRHR
NT seq 2163 nt   +upstreamnt  +downstreamnt
aatggaacttcccattccattatatttctatggtgccctccctgtagctacagtaaacta
actgtgtgtttactgtctgttccacagaccatagttcgagggaaccgtcccccgaaggaa
gcgtccatcaatggtctcctggaggagttcgacaacatatctgtgacacgttccaactcc
ctacgtaaagaaagccctacgggctcccaccaggctggggcccccaaacccgcctcccac
cacccccaacacccccatcccaacgaggagaacggcttcagccactattactcccggtac
tcctgtgacctggacacccccagtagggacttctctctggagccttacaggaaggacggt
aaaggctttgctccagatggggactgggccgtggggagacactaccgcttccccaaacag
aacggccacctcacccacgccacccgcatccccttctaccccgacgccatgcctcagaag
gccgattacgccaagctgcctccggactaccacacctacctggagagcaaggtggcaggg
gcgcgctcggccgacgaggtgggctctgggtccggggtgggcagcggaggggggtccgcc
gggtccacgacaggggggtactaccgtgcgtccgtaggtggctcgtccagtcaggactac
cgggacgcgtcaatggtggggacgccgtcccgcacctcgctgcacagcgagcaaatcaac
tacccggacagcgagtggagctacagcggcgtgtccagagatgaatacgagaagaggccc
aagtcgtcgtatgtgaggcagaacagccccacgccggccatcagacagcgctccaggtcg
gggtctggcctccaggagcccaacgtgccctacagggccagcggggtctttaagagtcct
cctcagacacacccctacagctcctacacctacccacgcctctcagagacactcaccaac
tcacaggccatggccaagggtgattacgaccagcagtcacgggacgggagtccccaggtc
ccagggtctgacacgtacccccgcgggcccctcaaactacctcagagtcacaacaagccc
tctggctacccccccggacacctccagtaccccgctgtgttccaccactacaaaccctcc
ccctaccaccacccaccctcacagcccagcccgccatacaccccacagggggcatattcc
cagccatcgtccctctacattcccctgggggcctacccccctccttcctggggctccagt
tcagacgcccagccctccagggtctcccacgaacagttcagggccgccctgcagctcgtc
gtcaacccaggtgaccccagggagtacttggacagtttcataaaaattggcgagggctcg
acgggcatcgtgtgcattgccagcgagaagcacagtggcaagcaggtggccgtcaagaag
atggacttgaggaaacagcagaggagagaactgctcttcaacgaggtggtgatcatgagg
gactatcaccatgagaacgtggttgacatgtacaacagctacctggtcggagacgagctc
tgggttgttatggagttcctggagggcggggccctgacggacattgtcactcacacgagg
atgaatgaggagcagatagccacagtgtgtgtgttggtgttgagggctctatcgtacctc
cacatacagggagtcatccacagagacatcaagagtgattctatcctcctgaccagcgat
ggacggatcaagctgtcagactttggcttctgtgcccaagtgtccaaagaggtgcccaag
aggaagtctctggtgggcacgccctactggatggcaccagaggtcatctcacggttaccc
tacggcacggaggtggatatctggtcgttgggcatcatggtgatagagatgatcgatggg
gaacccccgtactttaacgaaccccctctacaggctatgaggaggatacgagacaacctg
cccccacggataaaggagtcacacaaggtatcgtcggtgctgagggccttcctggacctg
atgttggttagagagccgtctcagcgagccacagcccaggagctgctccagcaccccttc
ctcaagctgtcgggtcccccatcctgcatcgtccccctaatgaggcactaccgccaccgc
tga

KEGG   Salmo salar (Atlantic salmon): 106610869
Entry
106610869         CDS       T04363                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 6-like
  KO
K05735  p21-activated kinase 6 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106610869
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106610869
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106610869
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106610869
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE20 family
   106610869
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 106610869
NCBI-ProteinID: XP_014065986
UniProt: A0A1S3SNR9
LinkDB
Position
ssa09
AA seq 688 aa
MFRKKKKKRPEISAPKNFEHRVHTSFDAKRGCFVGLPTQWHSLIENLRRPKPMVDPSRIT
PVELNPKKTIVRGSMIGHGDYISAMISDMSRLSVTSSNSLRKSSPSGRKRAQSLGRLGEV
KEGDTYQYEDLGEDDMEQQQWRDRAHNIHSESGMPQMGMKKSITLQPNGDLPRAKSTYEV
SVSSLEGPPVLSQPIQVPIKGAYISCEVGSPTERLMVRRDFQVPRVMPHNQRPFSCFYNP
AMAVQLPHPDHGRHPPPEYRTNLYIHSHNSPSRPYSSYDLKAESALRHHQSGFLPSTPSS
PFMSGIRPHRTVRSSASYTLGLSPNMGLRLNGPDPFLRHSGCPNAPFPRQDSPSQPRPSP
TGSLATSPPGTCSPAFRPPQHPQRPPPDPPKVTHEQFKAALQMVVDKGDPRSYLENFVKI
GEGSTGVVCIAREKHSGRQVAVKMMDLRRQQRRELLFNEVVIMRDYQHRNVVEMFKSALV
EEELWVIMEYIEGGALTNIVSETRLSEEQIATVCEAVLQALAYLHSQGVIHRDIKSDSIL
LTLDGRIKLSDFGFCAQISKDIPKRKSLVGTPYWMAPEVISKSPYSTEVDVWSLGIMVVE
MVDGEPPYFSETPVAAMRRLRDEPAPTVRNTTQVSPVLKDFLNRMLTRDPVERASATDLL
EHPFLLQSGSTQCLVPLVEQYRKRMSHC
NT seq 2067 nt   +upstreamnt  +downstreamnt
atgtttcgtaagaagaaaaagaagaggccagagatctcagcaccaaagaactttgagcac
cgggtgcacacctcttttgacgctaaacggggctgcttcgtgggcctgccaacccaatgg
cacagtttgatagagaacctccgcaggcccaagcctatggtggacccctcccggatcacc
ccagttgagctcaatccaaagaagaccatcgtgcgtgggagtatgatcggccatggagac
tacatctcagccatgatctccgacatgagcaggctgtccgtgaccagctccaactcccta
aggaagagcagcccttcaggcaggaagagggcccagtcccttggcaggctgggggaggtg
aaggagggggacacctaccagtatgaagatctgggagaggatgacatggagcagcagcag
tggagggacagggctcataacatccacagtgagagtgggatgccccaaatgggcatgaag
aagagcatcaccctgcagcccaacggtgatcttcccagggccaagtccacctacgaggtg
agtgtcagctctctggagggacccccggttctgtcccagcccatacaggtgcctattaag
ggggcttatatcagctgtgaggtgggcagtcccacagagagactgatggtgaggagagac
ttccaggtgccgagggttatgccacacaaccagaggcccttctcatgcttctacaaccca
gccatggctgtccagctgccccatcctgatcatgggcgtcacccccctccggagtaccgc
acaaacctctacatccactcccacaacagccctagcagaccatactcctcctacgacctg
aaggcagagtcggctctgaggcaccaccagtcaggcttcctacccagcacccccagcagt
cccttcatgagtggcatcaggccccacaggacggtgcgctcctcagccagctacaccctg
ggactgtctcccaacatgggcctgagactcaatggccctgacccctttttgagacactca
ggctgccctaatgctcccttccccaggcaggacagcccctcccagccccggccctccccc
accggctccctggccaccagccccccaggcacatgctcccctgctttcagaccccctcag
cacccccagaggccgccaccagacccccccaaggtgactcatgaacagtttaaggctgcc
ctgcagatggtggtagacaagggggaccctcggtcgtacctggagaactttgtgaagatt
ggcgaaggttcgacgggggtggtgtgtatcgctcgggagaaacacagcggcaggcaggtg
gccgtgaagatgatggacctgcggagacaacagcgaagagagctacttttcaacgaggtg
gtgatcatgagggactaccagcacaggaacgtggtggagatgtttaagagtgccctggtg
gaggaggagctctgggtcatcatggagtacatagagggtggagcactaaccaacatcgtg
tctgagaccaggctgagtgaggagcagatagccacagtgtgtgaggctgtgctgcaagcc
ctggcctaccttcactcccagggagtcatccacagggacatcaagagtgactccatactg
ctaacactggatgggaggatcaagctgtcagactttgggttctgtgcacagatcagtaag
gacattcccaagaggaagtctttagtaggaacaccatactggatggctccggaggtcatc
tctaaatctccatacagcactgaggtggatgtgtggtctctgggcatcatggtagttgag
atggtggacggagagcccccctacttcagtgagacccccgttgcagccatgagaagactg
agggatgagccagctcccaccgtacggaacacaacccaggtatcgccggtgctgaaagac
ttcctgaaccgtatgttgacccgggacccagtggagagggccagcgccacagacctgcta
gaacaccccttcctcctgcagagcggctccacgcagtgcctggtgcccctggtggagcag
taccgcaagcgcatgtctcactgctga

KEGG   Salmo salar (Atlantic salmon): 106612596
Entry
106612596         CDS       T04363                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 4-like
  KO
K05734  p21-activated kinase 4 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106612596
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106612596
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106612596
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106612596
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE20 family
   106612596
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 106612596
NCBI-ProteinID: XP_014069369
UniProt: A0A1S3SYF7
LinkDB
Position
ssa09
AA seq 661 aa
MFTKKKKPRVQISAPSNFEHRVHTDFDEQEQKFVGLPRQWQSLIEDTAKRPKPFIDVTVI
TTVEPRKTIVRGSKIAVDGSLTWLLDEFDTMSVTRSNSLRRGSPPIQPRRDSGSSGGGGH
ENGDLAYQQHHHPDHYGDIRDRERPRPDQLAGGDPRQPQRVPRSQREDCRPQQQPRGQEP
SSRHRERERPGPPPPPPKPRDMDPRDHHDQVVRREGPSDKRPKSSYTGRDGSPQSPRDKR
PLSGPNIRMPNLPVTEGVIKTAQQSSRPFNTYPRTDSEGGRSPTSQELKPARPHEAPPHN
GPSSASSRDGGKAPQKGQLRGDPHHTSHPVLGPEPPHGHQQQKAPVPRPPAPALPPQQAL
SPQREPQRVSHEQFRAALQMVVDPGDPRTYLDHYIKIGEGSTGIVCIATIKSTGKLVAVK
KMDLRKQQRRELLFNEVVIMRDYHHDNVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHT
RMNEEQIATVCLSVLKALSVLHTQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVQ
RRKSLVGTPYWMAPELISRLPYGPEVDIWSLGVMVIEMVDGEPPYFNEPPLKAMKMIRDN
LPPKLKNLHKVSPLLKGFLDKLLVRDPTQRASANELLKHPFLSKAGPPSCIVPLMRQNRM
R
NT seq 1986 nt   +upstreamnt  +downstreamnt
atgttcactaagaagaagaagccccgtgtccagatctcggcgccctccaacttcgagcac
cgcgtgcacacagactttgacgagcaggaacagaagtttgtggggctgccgcggcaatgg
cagtctctgatcgaggacacggccaagaggcccaagcccttcatcgacgtcaccgtcatc
accacggtggagccccgcaagaccatagtgcggggtagtaagatcgctgttgacggctcg
ctgacatggctgctggatgagtttgacaccatgtcggtgacccgctccaactccctgagg
cgaggcagcccccctatccagccccgcagagactccggatcctcggggggaggaggccat
gagaacggggacctggcctaccagcaacaccaccacccagatcactatggagacatcaga
gacagggagcggcccaggccggaccagttagctggtggagacccccggcagccccagcgg
gtaccccgctctcagcgagaggactgcagaccacagcagcagcctcggggccaggaacca
agcagcaggcaccgagagagggagcgtcccggcccaccccctcccccgccaaagcccaga
gacatggacccacgggaccaccacgaccaggtagtccgcagggaagggcccagcgacaag
aggcctaagtccagctacacgggcagggacggcagcccccagtcgccccgggataagagg
cctctctcggggcccaacatccgtatgcctaacctgcctgtcacagagggggtgataaag
acagcacagcagagcagcaggccgttcaacacctacccccgcactgacagtgaaggagga
aggagccccaccagccaggagctgaagccagccagaccacatgaagcaccgccacacaac
ggtccttctagtgcctccagccgagatgggggaaaagcaccacagaagggccagctacga
ggagacccccaccacacctcccaccctgtcctgggccctgagcccccccacggccaccag
cagcagaaggctcccgttccccgtcccccggcccctgccctaccaccacagcaggccctc
tcgccccagagggagccccagcgggtgtcccatgaacagttccgcgccgcgctgcagatg
gtggtggacccaggtgacccgcgcacctacctggaccactacatcaagatcggagagggc
tccactggtattgtgtgcattgccaccatcaagagcactggcaaattggtggctgtcaag
aagatggacctgcgcaagcagcagcgccgggagctgctattcaatgaggtggtgatcatg
cgggactatcaccatgacaatgtggtggagatgtacaacagctacctggtgggagatgaa
ctctgggtcgtcatggagttcctggagggaggggctctgactgacattgtcacacacacc
aggatgaatgaggagcagatagccacagtgtgcctgtctgtgctgaaggctctgtcagtg
ctgcacacccagggcgtcatccatagagacatcaagagtgactccatcttgctcacccac
gatggcagagtgaagctgtcagactttggcttctgcgcccaggtgtcgaaagaggtccag
cggcgcaagtccctggtgggcacaccctactggatggccccggagctcatctcacgactg
ccctatgggcctgaggtggacatctggtccttgggggtgatggtgatcgagatggtggac
ggagaacccccctatttcaatgagccccccctcaaagctatgaagatgatccgtgacaac
ctaccacccaaactcaagaacttacacaaggtttctcctctcctcaagggcttcctggac
aaattgttggtgcgagaccccacccagagggcctcagccaatgagctactcaagcacccc
ttcctgagcaaggctggcccgccctcctgcattgtgcctctcatgaggcagaaccgcatg
agatga

KEGG   Salmo salar (Atlantic salmon): 106612881
Entry
106612881         CDS       T04363                                 

Definition
(RefSeq) serine/threonine-protein kinase PAK 1-like
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106612881
   04012 ErbB signaling pathway
    106612881
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106612881
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106612881
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106612881
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106612881
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106612881
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE20 family
   106612881
Membrane trafficking [BR:sasa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    106612881
 Endocytosis
  Macropinocytosis
   Kinases
    106612881
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     106612881
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like APH Kdo DUF3402
Other DBs
NCBI-GeneID: 106612881
NCBI-ProteinID: XP_014069967
UniProt: A0A1S3T043
LinkDB
Position
ssa09
AA seq 553 aa
MSDNGDIEDKPPAPPMRNTSTLIGSCSKDPAPHGSKPLPPNPEDRKKKDRSIRSILTGGG
DKTNKKKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQA
VLDVLKFYDSKETNNSQKYMSFTDKSSDNYSCSKTASSKAVSETPAIATVSEDEEDEAMP
PPVVAPRPEHTKSIYTRSVIDPLPAPPTRDVATSPISPPPPEGATSTITPPTSPTPSPAP
GPSMPRPADKTRKKKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAIDIAT
GQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGEELWVVMEYLAGGSL
TDVVTETCMDEAQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGIDGSVKLTDFGFCA
QITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRA
LYLIATNGTPELQNPEKLSSVFRDFLTCCLEMDVEKRGSAKDLLQHQFLKVAKPLSSLTP
LILAAKEAAKANR
NT seq 1662 nt   +upstreamnt  +downstreamnt
atgtctgataatggggacatcgaggacaagcccccagccccgcccatgaggaacaccagc
actctgattggctcctgcagcaaagatcctgccccccatggctccaagcccctccccccc
aacccagaggacaggaagaagaaagatcgctccatcaggtccatcctgacaggaggagga
gacaagaccaacaagaagaaggagcgtccagagatctctctgccttctgattttgaacac
accatccatgtgggcttcgatgcagtcactggagagttcacaggcatgccggagcaatgg
gctcggttgctccagacctctaacatcactaagctggaacagaagaagaatcctcaggct
gtccttgacgttctcaagttctacgactccaaggagaccaacaacagccagaagtacatg
agctttacagacaagagttcagacaactacagctgttccaaaactgccagctccaaggct
gtgtcagagacgcctgccatagcaaccgtatctgaggacgaggaagatgaggccatgccc
cctcctgttgtcgctccccgaccagaacacaccaaatcaatatacactcgttctgtcata
gatccactcccagctcctcccaccagagacgttgccacgtcgcctatctcccccccacct
ccggagggcgccacctccaccatcacaccccccactagccccacccctagtcctgcacct
ggcccctccatgccacgccccgcagacaaaacacgcaagaagaagatgtctgatgaagag
atactggagaaactgcggagtatagtcagtgtgggagaccccaagaagaaatacactcgc
tttgagaagattggacagggtgcgtcaggtacggtatatacagccatagacatcgctaca
ggccaggaggtggccattaaacagatgaacctgcagcagcagcccaagaaggagctcatc
atcaacgagatcctggtcatgagggaaaacaagaaccccaacatagtcaactacctggac
agttacctggtgggggaggagctatgggtggtgatggagtatctggctggaggttctctg
actgacgttgtcacggagacatgtatggacgaggctcagatcgctgctgtgtgtcgggag
tgtctgcaggccttggagttcctccattctaaccaggtgatccatcgcgacatcaagagt
gacaacatccttctgggaatagacggatcagtgaaactcactgactttgggttctgtgcc
cagatcactccagagcagagtaagaggagcaccatggtggggactccctattggatggct
ccagaggtggtgaccaggaaggcttatggtcctaaagttgacatctggtctctaggcatc
atggctatagagatggtggagggagaacccccttacctcaatgagaacccactcagggcg
ttgtatctgattgcgaccaacgggactccagaacttcagaacccagagaaactgtcctca
gtcttcagagacttcctcacctgttgcttggagatggatgtggagaagagagggagcgct
aaagacctactacagcaccagttcctgaaggtggccaagcctttatccagtctgactcct
ctcatcctggcagccaaagaagcagccaaggctaaccgctaa

KEGG   Salmo salar (Atlantic salmon): 106613860
Entry
106613860         CDS       T04363                                 

Gene name
pak2
Definition
(RefSeq) p21 (RAC1) activated kinase 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04510  Focal adhesion
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106613860 (pak2)
   04012 ErbB signaling pathway
    106613860 (pak2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106613860 (pak2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106613860 (pak2)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106613860 (pak2)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE20 family
   106613860 (pak2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Pkinase_fungal Kinase-like APH Kdo zinc-ribbons_6 Haspin_kinase
Other DBs
NCBI-GeneID: 106613860
NCBI-ProteinID: XP_014072020
UniProt: A0A1S3T603
LinkDB
Position
ssa10
AA seq 530 aa
MCDNGDTEDKPPAPPVRMSSTIFSTGSSKDPLSANHSSKPLPSVPEERKPRNKIISIFSG
AEKGGRKKDRDKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQK
KNPQAVLDVLKFYDSTGNGRQKYLSFSSSEKDGFPTGPQSPVKNVTEPSSTNIKDIDDDD
DDEAPPPIVAPRPEYTKSVYTRSVIDPIPAPATCPDGDSASKAVDRQKKKGKMSDEEIMD
KLRTIVSIGDPKKKYTRYERIGQGASGTVYTAIDVATGQEVAIKQINLQKQPKKELIINE
IMVMKELKNPNIVNFVDSFLVGEELYVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQ
ALEFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEV
VTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFR
DFLNRCLEMDVEKRGGGKELLQHPFLKLAKPLSSLTPLILAAKEAMKGNH
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgtgtgataacggtgataccgaggacaagccccctgcccccccggtccggatgagcagc
accattttcagcacaggctccagcaaggacccactctcagccaatcacagctccaagccc
ctgccctcggttccagaggagaggaaaccccgcaacaagatcatctccattttctcaggc
gcagagaaaggtggtagaaaaaaagaccgggacaaagaacgaccagagatctctccgcct
tcagactttgaacacaccatccacgttggctttgatgctgtcactggggagttcactggc
atgccagagcaatgggcacgacttctccagacatcaaacatcaccaagtccgagcagaag
aagaacccacaggctgttctggacgtgctcaaattctatgactctacgggcaacggccgc
cagaaatacctcagtttctcctcctctgaaaaggatggtttccccaccggaccccagtct
ccggtcaaaaatgtcactgaaccctcatcgaccaatatcaaggacattgatgatgatgat
gatgatgaagctcccccacccattgtggcaccacgtccagaatacactaagagtgtgtac
actcgctccgtcattgaccccatccccgctccagccacatgtccagatggagactcggcc
tccaaggctgtagacagacagaagaagaagggaaagatgtcagacgaggagatcatggac
aaactgagaactatagtcagcattggagatcctaaaaagaagtacacgagatatgaaaga
attggacagggggcttcggggacagtgtacacagccattgatgttgccacaggacaagag
gtggccattaaacagatcaacctacagaagcagcccaagaaggagctgatcataaatgaa
attatggtgatgaaagagttaaagaacccgaatattgtcaacttcgtagacagtttcctg
gtgggagaggagctctatgtggtgatggagtacttggctggtggctcgctgactgatgtg
gtgacagagacctgcatggacgaggctcagatagctgctgtctgcagagagtgtttacaa
gcactggagttccttcatgcgaaccaggtcatccatcgtgacatcaagagtgacaacgtg
ctattggggatggatggctctgtcaagctcaccgattttggtttctgcgcccagatcact
ccagagcagagcaagcgcagcaccatggtggggacgccttactggatggcacctgaagtg
gtgacccggaaggcctatgggccaaaggttgatatctggtccctgggcatcatggccatt
gagatggttgagggggagcctccatacctcaatgagaacccgctaagagcactgtacctg
attgctaccaatggcactccagagctgcagaacccagaaaagctgtcccccatcttcaga
gacttccttaaccgctgcctagaaatggatgtggagaagagaggcgggggaaaagagctg
ctgcagcatcccttcctgaagctggcaaagcccctctccagtcttacacctctcatcttg
gctgctaaggaggccatgaaaggcaaccattaa

DBGET integrated database retrieval system