KEGG   Salmo salar (Atlantic salmon): 100380364
Entry
100380364         CDS       T04363                                 

Gene name
tnr6
Definition
(RefSeq) Tumor necrosis factor receptor superfamily member 6
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04060  Cytokine-cytokine receptor interaction
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100380364 (tnr6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100380364 (tnr6)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100380364 (tnr6)
   04217 Necroptosis
    100380364 (tnr6)
   04115 p53 signaling pathway
    100380364 (tnr6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100380364 (tnr6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sasa04050]
    100380364 (tnr6)
   04090 CD molecules [BR:sasa04090]
    100380364 (tnr6)
Cytokine receptors [BR:sasa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100380364 (tnr6)
CD molecules [BR:sasa04090]
 Proteins
  100380364 (tnr6)
SSDB
Motif
Pfam: Death TNFR_c6 DUF148
Other DBs
NCBI-GeneID: 100380364
NCBI-ProteinID: NP_001167120
UniProt: C0HA07
LinkDB
Position
ssa01
AA seq 330 aa
MNKYTFLYSLCILCTVRLTTPLKAERSSQDILITSKLRTKRQSCQDGTYQHEGMACCLCA
AGQHLERHCSVSPEDGTCVNCEKDRTYNSDPNSLDSCEPCTSCNPKANLEVEDRCTIFKD
SVCRCQQGHYCNKGKEHCRACYPCTTCREEGIKVACTATNNTICNAFKEQGSNLAAVLVL
TTVLLVALIVIFCLWKNNKYCFGPNGGLTELPNRSLEEMQPLRGVDLRPHLPDIAKTLGW
KDMKQLAEGSGMTHTDIESHQLNFPNDSQEQCSSLLRAWVEKEGMTTASETLVQTLRRMK
KKVKAEDIMAIISNKEDAITRKNSGSDAVP
NT seq 993 nt   +upstreamnt  +downstreamnt
atgaacaaatatacttttttatatagcctgtgcattttgtgtaccgttcgtttaactaca
ccattgaaagcagagcggagttcccaagacatcttaatcactagcaaattgcgcaccaaa
aggcagagttgtcaagatggcacttaccagcatgagggaatggcatgctgtctctgtgcg
gctggccaacatctggagagacactgcagtgtgagcccagaggatggaacctgtgttaac
tgtgagaaagataggacctacaacagtgaccccaactccctggactcctgtgagccctgc
acttcctgtaaccctaaagccaatctggaggtggaggacagatgcaccatcttcaaggac
tcagtatgtcgatgccagcagggccactactgtaacaaggggaaggagcactgcagggcc
tgctacccatgtaccacatgcagggaagagggcatcaaggtagcctgtaccgccaccaac
aacaccatatgcaatgccttcaaagaacaaggaagcaatttggcagcagtattggtcctg
actactgttcttcttgtcgctttgattgtgatcttttgcctgtggaaaaataataaatat
tgttttgggccaaatggtggtttgacagaactgcccaaccggagtttagaggaaatgcag
ccactgagaggtgttgatctcaggccacacctcccagacatcgctaagaccttggggtgg
aaggacatgaaacagttggccgagggcagtgggatgacacataccgacatagaatcccac
cagctgaactttcccaatgactcccaggagcaatgctccagcctactgagggcctgggtg
gagaaggaggggatgaccacagcctctgagacactggtccagactctacgccgcatgaag
aaaaaggtcaaggcagaggatatcatggctatcatcagcaacaaggaggatgccatcaca
aggaaaaactcaggatcagatgcagtgccttag

KEGG   Salmo salar (Atlantic salmon): 106577010
Entry
106577010         CDS       T04363                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6-like
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04060  Cytokine-cytokine receptor interaction
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106577010
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106577010
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106577010
   04217 Necroptosis
    106577010
   04115 p53 signaling pathway
    106577010
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106577010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sasa04050]
    106577010
   04090 CD molecules [BR:sasa04090]
    106577010
Cytokine receptors [BR:sasa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   106577010
CD molecules [BR:sasa04090]
 Proteins
  106577010
SSDB
Motif
Pfam: TNFR_c6 Death
Other DBs
NCBI-GeneID: 106577010
NCBI-ProteinID: XP_014010122
UniProt: A0A1S3N405
LinkDB
Position
ssa18
AA seq 328 aa
MWKMNKYTFLCVLCILCIVRSATTSKAEPSSQDITVKLRIKRQSCQDGTYQHEDKTCCLC
SAGYHLDSHCSMNLDYGTCIHCEPGRTYNSYPNFLDSCEPCTSCNPKANLEVEDKCTTSR
DTVCRCQQGHYCDKGKVHCRACYPCTICGNEGTKVACTPTNNTICHDDQKQGGGRSHAAV
LASVMVFAVCLIFCCLRRNNKCCFGKKLGQNGGLTKMANRSSEVAMEMQPLRGIDLWPHL
LDIAKTLGWKDMKQVAERSGMTIATIEFHQLNYPNDTQEQCSSLLRAWVENEGMTTASET
LIQTLRRMEKNAKADNIMAIIRSKENTV
NT seq 987 nt   +upstreamnt  +downstreamnt
atgtggaagatgaacaaatatacgtttctatgtgtcctgtgcattttgtgtatagttcgt
tcagctacaacttccaaagcagagccgagttcccaagacataaccgtcaaattgcgcatc
aaaaggcagagttgtcaagatggcacttaccagcatgaagacaagacatgctgtctctgt
tctgctggctatcatctggacagccactgtagtatgaacttagactatgggacctgtatt
cactgtgagccaggcagaacctacaacagttaccccaacttcctggactcttgtgagccc
tgcacatcttgcaaccctaaagccaatctggaggtggaggacaaatgtaccacctccagg
gacacagtgtgtcgatgccagcagggccactactgtgacaaggggaaggtgcactgcagg
gcctgctacccgtgtaccatatgtgggaatgaaggtaccaaggttgcctgtacccccacc
aacaacaccatatgccatgacgaccaaaaacaaggaggaggaagaagtcatgcagcagta
cttgcctcagttatggtttttgcagtttgtcttattttttgctgcctgaggcgaaataat
aaatgttgttttgggaaaaagctggggcaaaatggtggtttgaccaaaatggccaaccgg
agttcagaggtagctatggaaatgcagccactgaggggtattgacctctggccacacctc
ctagatatcgctaagaccttggggtggaaggacatgaaacaggtggccgagcgcagtggg
atgactattgccaccatagaattccaccagctaaactatcccaatgacacccaggagcag
tgctccagcctacttagggcctgggtggagaacgaggggatgaccacagcctctgagaca
ctgatccagactctacgccgcatggaaaaaaatgccaaggcagataatatcatggctatc
atcagaagcaaggaaaacacagtttag

DBGET integrated database retrieval system