KEGG   Salmo salar (Atlantic salmon): 100380410Help
Entry
100380410         CDS       T04363                                 

Gene name
k6pp
Definition
(RefSeq) 6-phosphofructokinase type C
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00010  Glycolysis / Gluconeogenesis
sasa00030  Pentose phosphate pathway
sasa00051  Fructose and mannose metabolism
sasa00052  Galactose metabolism
sasa01100  Metabolic pathways
sasa01200  Carbon metabolism
sasa01230  Biosynthesis of amino acids
sasa03018  RNA degradation
Module
sasa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100380410 (k6pp)
   00030 Pentose phosphate pathway
    100380410 (k6pp)
   00051 Fructose and mannose metabolism
    100380410 (k6pp)
   00052 Galactose metabolism
    100380410 (k6pp)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    100380410 (k6pp)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    100380410 (k6pp)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:sasa03019]
    100380410 (k6pp)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100380410 (k6pp)
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100380410 (k6pp)
Messenger RNA biogenesis [BR:sasa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100380410 (k6pp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 100380410
NCBI-ProteinID: NP_001167165
UniProt: C0HAA0
LinkDB All DBs
Position
ssa03
AA seq 783 aa AA seqDB search
MTKRQDTKKFFENLSGAGKSIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFVHEGYQG
MVDGGDNIEEASWESVSSMLQVGGTVIGSARCKEFRSHEGRLKAAHHLVQRDITNLCVIG
GDGSLTGANLFREEWSGLLEELVQQGLIDEQAAQNNSELHIVGMVGSIDNDFCGTDMTIG
TDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEMPPED
GWEEQMCQKLSENRADKKRLNIIIVAEGAIDSHNKPITTDHIKELVVSCLGFDTRVTILG
HVQRGGTPSAFDRILASRMGVEAVLALLEASASTPACVVSLCGNQAVRLPLMECVQMTQD
VQKAMDEKNFEEAVRLRGRSFENNLNTYKLLSYRKADSELPNSSFNVAVLNVGAPAAGMN
AAVRSAVRVGITEGHKMFAVNDGFEGFYKGQIKEIKWGDVGGWTGQGGSILGTKRTLPAK
HLDKIAEQIRIHNINALLVIGGFEAFECLLQLYEARTSHEDFCIPMCVLPATISNNVPGT
DLSIGADTSLNAIVETCDRIKQSASGTKRRVFIIETMGGYCGYLASVGGLAAGADAVYIY
EEPFDIRDLQSNVEHLTEKMKTGIQRGLVLRNENSNENFTTDFIYQLYSEEGKGVFDCRK
NVLGHMQQGGAPSPFDRNFGTKIAAKAIQWISRKLKESYKEGKVFANTEDTACLLGMRRR
AMVFQPVVQLKDQTDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVTRVRPK
KVD
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagcggcaggacaccaagaaattctttgagaatctttccggtgctggaaaatcc
atcggcgttctgacaagcggaggagatgctcaaggtatgaatgctgctgtacgggctgtg
gtccgcatgggtatttatgtgggagctaaagtctacttcgtccatgagggttaccagggt
atggtagatggtggggataacattgaagaggcatcatgggaaagtgtctcaagcatgctg
caagtgggtggcacagtcattggcagtgcccgctgcaaggagttccgcagccacgagggg
cgtctgaaggctgcccaccacctggtgcagcgtgacatcaccaacctgtgtgtgatcgga
ggggacggcagcctcactggggccaacctcttcagagaggagtggagcggactgctggag
gaactggtccagcagggtctgattgatgagcaggctgcccagaacaactcagagctgcac
atcgtgggaatggtgggctccatcgacaacgacttctgtggcactgacatgaccatcggg
acagactctgccctgcacagaatcatagaggtggtggacgcaatcatgaccacagcccag
agccaccagaggacgtttgtgctggaggtcatgggaagacattgtgggtacctggcccta
gttagtgctctggcctgtggggctgactgggtgctgatccctgagatgccccctgaggac
gggtgggaggaacagatgtgtcagaaactgtctgagaaccgtgcagataagaaacggctc
aatatcattattgtagctgagggggcgatagattctcacaacaagcctatcactacagac
catattaaggaactggttgttagctgtctgggctttgacacccgagtcaccatcctgggt
cacgtccagagaggaggaaccccctctgccttcgaccggatcctggccagtcgtatggga
gtggaggcggtcctggccctgttggaggcgtcagccagcaccccggcctgcgtcgtgtct
ctgtgtgggaaccaggctgtccgtctgccccttatggagtgtgttcagatgacacaagac
gtccagaaagccatggacgagaagaattttgaggaagctgtgagactgcgtggcaggagt
ttcgaaaacaacctgaacacctacaaactcttgtcttaccggaaagcagactctgaactc
ccaaatagctccttcaacgtggcggtgctgaacgtgggtgcccctgctgcgggcatgaac
gcagctgtccgctcggccgtcagggtgggcatcaccgaggggcacaagatgttcgccgtt
aacgacggcttcgagggattctacaagggacagataaaggagattaaatggggagatgta
ggtggttggactggacaaggggggtccatactgggaacaaagagaacccttccagcgaag
catcttgataagatagctgaacaaatcaggatacataacattaatgctttgcttgttatc
ggtggatttgaggcgtttgagtgtttgctgcagctctatgaggcccggaccagccatgag
gacttttgcatcccgatgtgtgtgcttcctgccaccattagtaacaatgtgcctggtact
gatctgagtatcggggcagacacttccctcaatgccatcgtggagacatgtgaccgcatc
aagcagtctgccagtgggaccaagcggcgtgtgttcatcattgagaccatgggagggtac
tgtgggtacctggccagtgtcggggggctggctgcgggggctgacgctgtctacatctat
gaggaacccttcgacatcagagatctccagtccaacgtcgagcatttgacagagaagatg
aagacgggcatccagaggggcttggtgctgaggaatgagaactccaatgagaacttcacc
acagatttcatctaccagctgtactctgaggaggggaaaggagtgtttgactgcaggaag
aatgtccttggacatatgcagcagggaggtgctccttccccattcgacaggaactttgga
acgaagattgcagccaaagcgattcaatggatttcaagaaagctcaaggagtcatataaa
gaagggaaggtgtttgctaacacagaggacactgcctgtttgctggggatgcgtcgcaga
gccatggtcttccaaccagtggtgcagctcaaagaccaaacagacttcgtccacaggatc
cctaaggaacagtggtggttgaagctccgccccctgatgaagatcctggctaagtacaag
accagctacgatgtgtctgactctggccagctggagcatgtgacccgggtcaggcccaag
aaggtggactga

DBGET integrated database retrieval system