KEGG   Salmo salar (Atlantic salmon): 100380511
Entry
100380511         CDS       T04363                                 

Gene name
mk03
Definition
(RefSeq) Mitogen-activated protein kinase 3
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04114  Oocyte meiosis
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04270  Vascular smooth muscle contraction
sasa04350  TGF-beta signaling pathway
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04520  Adherens junction
sasa04540  Gap junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100380511 (mk03)
   04012 ErbB signaling pathway
    100380511 (mk03)
   04350 TGF-beta signaling pathway
    100380511 (mk03)
   04370 VEGF signaling pathway
    100380511 (mk03)
   04371 Apelin signaling pathway
    100380511 (mk03)
   04068 FoxO signaling pathway
    100380511 (mk03)
   04150 mTOR signaling pathway
    100380511 (mk03)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100380511 (mk03)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100380511 (mk03)
   04210 Apoptosis
    100380511 (mk03)
   04218 Cellular senescence
    100380511 (mk03)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100380511 (mk03)
   04520 Adherens junction
    100380511 (mk03)
   04540 Gap junction
    100380511 (mk03)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100380511 (mk03)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100380511 (mk03)
   04621 NOD-like receptor signaling pathway
    100380511 (mk03)
   04625 C-type lectin receptor signaling pathway
    100380511 (mk03)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100380511 (mk03)
   04912 GnRH signaling pathway
    100380511 (mk03)
   04914 Progesterone-mediated oocyte maturation
    100380511 (mk03)
   04916 Melanogenesis
    100380511 (mk03)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100380511 (mk03)
   04270 Vascular smooth muscle contraction
    100380511 (mk03)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100380511 (mk03)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    100380511 (mk03)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    100380511 (mk03)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    100380511 (mk03)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100380511 (mk03)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100380511 (mk03)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     100380511 (mk03)
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100380511 (mk03)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo FTA2 Choline_kinase YukC
Other DBs
NCBI-GeneID: 100380511
NCBI-ProteinID: NP_001167267
UniProt: C0H802
LinkDB
Position
ssa23
AA seq 389 aa
MADSSNSAASTGATGSNTGAAGAVEPEGATGATGIKPVLEVVKGQNFDVGPRYVNLSYIG
EGAYGMVCSANDGMTDSRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDILRA
RRIECMRDVYIVQDLMETDLYKLLKTQMLSNDHTCYFLYQILRGLKYIHSANVLHRDLKP
SNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYSKSIDIW
SVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPTPDDLNCIINMKARNYLQSLPEKPK
IPWNKLFPKADSKALDLLGRMLTFNPIKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFT
MELDDLPKEKLKELIFEETFRFQATYQGS
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggcggattcgagcaacagtgctgcttcgactggagctacaggctcgaatactggtgcc
gccggggctgttgagcccgagggagctactggagctacggggatcaagcccgttttggag
gtggtaaaggggcagaactttgacgttggcccccgctatgtcaacctctcgtacatcggg
gaaggggcctatggaatggtttgctcggccaatgacggcatgacagattctcgcgtggcc
attaagaagatcagtccatttgagcatcagacgtactgtcagcgcacactgagggagatc
aagatcctgctgcggttccgccatgaaaacatcatcggcatcaacgacatcctgagggcc
cgccgcatcgagtgcatgagggacgtctacatagtgcaggacctgatggagacagacctg
tacaagctcctgaagacccagatgttgagcaacgaccacacctgctacttcttgtaccag
atcctgagaggcctgaagtacatccactctgccaacgtgctgcaccgtgacctcaagccc
tccaacctgctcatcaacaccacctgtgacctcaagatctgtgactttgggctggcacgg
atagctgacccagagcatgaccacacaggcttcctgacagagtatgtggctacgcgctgg
tacagggcccccgagatcatgctcaactccaagggctactccaagtccattgatatctgg
tcagtgggctgcatcctggctgagatgctgtccaacaggcccatctttcctgggaagcac
tacctggaccagctcaaccacatactggggatcctgggctctcccactccggatgacctg
aactgcatcatcaacatgaaggccaggaactacctgcagtctctgcctgagaaacccaag
atcccctggaacaagctgttccccaaggcggacagcaaggctctggacctgctgggccgc
atgttgacctttaaccctatcaagcgcatcacggtagaggaggccctggctcatccctat
ctggagcagtactacgaccccactgacgagcctgtagcagaggagccgttcactttcacc
atggagctggatgacctgcctaaggagaagctgaaggagctcatctttgaggagacgttc
cgcttccaggccacctaccagggctcctga

KEGG   Salmo salar (Atlantic salmon): 106570952
Entry
106570952         CDS       T04363                                 

Gene name
mapk1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04114  Oocyte meiosis
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04270  Vascular smooth muscle contraction
sasa04350  TGF-beta signaling pathway
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04520  Adherens junction
sasa04540  Gap junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106570952 (mapk1)
   04012 ErbB signaling pathway
    106570952 (mapk1)
   04350 TGF-beta signaling pathway
    106570952 (mapk1)
   04370 VEGF signaling pathway
    106570952 (mapk1)
   04371 Apelin signaling pathway
    106570952 (mapk1)
   04068 FoxO signaling pathway
    106570952 (mapk1)
   04150 mTOR signaling pathway
    106570952 (mapk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106570952 (mapk1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    106570952 (mapk1)
   04210 Apoptosis
    106570952 (mapk1)
   04218 Cellular senescence
    106570952 (mapk1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106570952 (mapk1)
   04520 Adherens junction
    106570952 (mapk1)
   04540 Gap junction
    106570952 (mapk1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106570952 (mapk1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106570952 (mapk1)
   04621 NOD-like receptor signaling pathway
    106570952 (mapk1)
   04625 C-type lectin receptor signaling pathway
    106570952 (mapk1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    106570952 (mapk1)
   04912 GnRH signaling pathway
    106570952 (mapk1)
   04914 Progesterone-mediated oocyte maturation
    106570952 (mapk1)
   04916 Melanogenesis
    106570952 (mapk1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106570952 (mapk1)
   04270 Vascular smooth muscle contraction
    106570952 (mapk1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106570952 (mapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106570952 (mapk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106570952 (mapk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106570952 (mapk1)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106570952 (mapk1)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106570952 (mapk1)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     106570952 (mapk1)
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106570952 (mapk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase FTA2 Kinase-like Kdo NDUF_B4
Other DBs
NCBI-GeneID: 106570952
NCBI-ProteinID: XP_013999028
UniProt: A0A1S3M6Y0
LinkDB
Position
ssa15
AA seq 366 aa
MATAAVCASGPNPGSGAELVRGQAFDVGPRYHNLSYIGEGAYGTVCSAYCRDNKVRVAIK
KISPFEHQTYCQRTLREIKILLRFKHENVISINDIILTPSIDQMKDVYIVQDLMETDLYK
LLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVA
DPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYL
DQLNHILGILGSPSQEDLNCIINIKARNYLLSLPLRCKVPWNSLFPKADPKALDLLDKML
TFNPHKRIEVEAALAHPYLEQYYDPTDEPVTEAPFKFDMELDDLPKETLKELIFEETARF
NTICRS
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggcgacagctgcggtatgtgccagtggtcccaaccccggatccggcgctgagttggtc
cggggacaagccttcgatgtcgggcctcgctaccacaatctgtcgtatatcggtgagggc
gcctacggaaccgtgtgctctgcatattgccgtgacaacaaggtccgcgtggcgataaag
aagatcagtccgtttgagcaccagacgtactgtcagaggactctgagagaaattaagatc
ctactgcgtttcaaacatgagaacgtcatcagcatcaacgacatcatccttacgccctcc
atcgaccagatgaaggacgtctacatcgtgcaggacctgatggagacggacctgtataag
ctcctgaagacccagcgcctgagcaacgatcacatctgttacttcctgtaccagatcctg
agaggcctgaagtacatccattctgccaacgtcctgcaccgcgaccttaaaccctccaac
ctgctgctgaataccacctgtgatctaaagatctgcgacttcggtctggcgcgtgtggct
gacccagaccatgaccacacgggcttcctgacggagtacgtagcgactcgctggtaccgg
gcgcctgagatcatgctcaactccaagggttacaccaagtctattgatatctggtctgtg
ggctgcatcctagctgaaatgctctccaatagacccatcttccctgggaagcactacctg
gaccagctgaaccacatcctgggtatcctagggtctccttcccaggaggatctgaactgt
atcatcaacattaaggccaggaactacctgctgtctcttccgctgcgctgcaaggtcccc
tggaacagcctcttccctaaagccgaccccaaagctctggacctgctggataagatgttg
acctttaacccccacaagaggatcgaggtggaggcggctctggctcacccttacctggag
cagtactacgatcctacagatgagcctgtaaccgaggctcccttcaagtttgacatggag
ctggatgatcttcccaaagagaccctgaaggagctgatctttgaagagacggctcgcttc
aacacaatctgcaggtcctaa

KEGG   Salmo salar (Atlantic salmon): 106592057
Entry
106592057         CDS       T04363                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04114  Oocyte meiosis
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04270  Vascular smooth muscle contraction
sasa04350  TGF-beta signaling pathway
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04520  Adherens junction
sasa04540  Gap junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106592057
   04012 ErbB signaling pathway
    106592057
   04350 TGF-beta signaling pathway
    106592057
   04370 VEGF signaling pathway
    106592057
   04371 Apelin signaling pathway
    106592057
   04068 FoxO signaling pathway
    106592057
   04150 mTOR signaling pathway
    106592057
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106592057
  09143 Cell growth and death
   04114 Oocyte meiosis
    106592057
   04210 Apoptosis
    106592057
   04218 Cellular senescence
    106592057
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106592057
   04520 Adherens junction
    106592057
   04540 Gap junction
    106592057
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106592057
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106592057
   04621 NOD-like receptor signaling pathway
    106592057
   04625 C-type lectin receptor signaling pathway
    106592057
  09152 Endocrine system
   04910 Insulin signaling pathway
    106592057
   04912 GnRH signaling pathway
    106592057
   04914 Progesterone-mediated oocyte maturation
    106592057
   04916 Melanogenesis
    106592057
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106592057
   04270 Vascular smooth muscle contraction
    106592057
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106592057
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106592057
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106592057
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106592057
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106592057
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106592057
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     106592057
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106592057
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Choline_kinase FTA2 Kinase-like Kdo NDUF_B4
Other DBs
NCBI-GeneID: 106592057
NCBI-ProteinID: XP_014038833
UniProt: A0A1S3QFP7
LinkDB
Position
Un
AA seq 276 aa
MNEHLQSSLFLNPLSPSYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSAN
VLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKG
YTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINIKARNYL
LSLPLRCKVPWSRLFPNADPKALDLLDKMLTFNPHKRIEVEEALAHPYLEQYYDPTDEPV
AEAPFKFDMELDDLPKETLKELIFEETARFNTVCRS
NT seq 831 nt   +upstreamnt  +downstreamnt
atgaatgaacacctccagtctagtttgttccttaaccccttgtctcctagctacatcgtg
caggacctgatggagacagacctgtataagctcctgaagacccagcacctgagcaacgat
cacatctgttacttcctgtaccagatcctgagaggcctgaagtacatccactctgccaac
gtcctgcaccgcgaccttaaaccctccaacctgctgctcaataccacctgtgatctaaag
atctgtgactttggtctcgcacgtgtggctgacccggaccacgaccacacgggcttcctg
acagagtacgttgcgactcgttggtaccgtgcacctgagatcatgctgaactccaagggt
tacaccaagtctattgatatctggtctgtgggctgcatcctggctgaaatgctctccaat
agacccatcttcccggggaagcactacctggaccagctgaaccacatcctgggtatccta
gggtctccttcccaggaggatctgaactgtatcatcaacatcaaggccaggaactacctg
ctgtctctcccgctgcgctgcaaggttccctggagccgcctcttccccaacgccgacccc
aaagctctggacctgctggacaagatgttgacctttaacccccacaagaggatcgaggtg
gaggaggctctggctcacccttacctggagcagtactacgatcctacagatgagcctgta
gccgaggctcctttcaagttcgacatggagctggatgatctacccaaagagaccctgaag
gagctgatctttgaagagactgcacgcttcaacacagtctgcaggtcctaa

KEGG   Salmo salar (Atlantic salmon): 106600714
Entry
106600714         CDS       T04363                                 

Definition
(RefSeq) mitogen-activated protein kinase 1-like
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04114  Oocyte meiosis
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04270  Vascular smooth muscle contraction
sasa04350  TGF-beta signaling pathway
sasa04370  VEGF signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04520  Adherens junction
sasa04540  Gap junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04916  Melanogenesis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106600714
   04012 ErbB signaling pathway
    106600714
   04350 TGF-beta signaling pathway
    106600714
   04370 VEGF signaling pathway
    106600714
   04371 Apelin signaling pathway
    106600714
   04068 FoxO signaling pathway
    106600714
   04150 mTOR signaling pathway
    106600714
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106600714
  09143 Cell growth and death
   04114 Oocyte meiosis
    106600714
   04210 Apoptosis
    106600714
   04218 Cellular senescence
    106600714
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106600714
   04520 Adherens junction
    106600714
   04540 Gap junction
    106600714
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106600714
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106600714
   04621 NOD-like receptor signaling pathway
    106600714
   04625 C-type lectin receptor signaling pathway
    106600714
  09152 Endocrine system
   04910 Insulin signaling pathway
    106600714
   04912 GnRH signaling pathway
    106600714
   04914 Progesterone-mediated oocyte maturation
    106600714
   04916 Melanogenesis
    106600714
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106600714
   04270 Vascular smooth muscle contraction
    106600714
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106600714
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106600714
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    106600714
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106600714
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106600714
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106600714
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     106600714
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106600714
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo FTA2 Choline_kinase YukC
Other DBs
NCBI-GeneID: 106600714
NCBI-ProteinID: XP_014047758
UniProt: A0A1S3R5W8
LinkDB
Position
ssa03
AA seq 389 aa
MADSSNSAAAAGATGSNTGAAGAVAPEGATGAAGIKPVLEVVKGQNFDVGPRYVNLSYIG
EGAYGMVCSAHDGMTDSRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDILRA
RRIECMRDVYIVQDLMETDLYKLLKTQMLSNDHTCYFLYQILRGLKYIHSANVLHRDLKP
SNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYSKSIDIW
SVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPTPDDLNCIINMKARNYLQSLPEKPK
IPWNKLFPKADSKALDLLGRMLTFNPIKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFT
MELDDLPKEKLKELIFEETFRFQATYQGS
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggcggattcgagcaacagtgctgcggcggctggagccacaggctcgaatactggtgcc
gccggggctgttgcgcccgagggagcgactggagctgcggggataaagcccgtgttggag
gtggtaaaggggcagaactttgacgttggcccccgctatgtcaacctctcgtacatcggg
gaaggggcctatggaatggtttgctcggcccatgacggcatgacggattctcgcgtggcc
attaagaagatcagtccgtttgagcaccagacgtactgccagcgcaccctgagggagatc
aagatcctgctgcggttccgccatgagaacatcatcggtatcaacgacatcctgagggcc
cgccgcatcgagtgcatgagggacgtctacatagtgcaggacctgatggagacagacctg
tacaagctcctgaagacccagatgttgagcaacgaccatacctgctacttcctgtaccag
atcctgagaggcttgaagtacatccactctgccaacgtgctgcaccgtgacctcaagccc
tccaacctgctcatcaacaccacctgcgacctcaagatctgtgactttgggctggcacgg
atagctgacccagagcatgaccacacaggcttcctgacagagtacgtggctacgcgctgg
tacagggcccctgagatcatgctcaactccaagggctactccaagtccattgatatctgg
tcagtgggctgcatcctggctgagatgctgtccaacaggcccatcttccctgggaagcat
tacctggaccagctcaaccacatactgggcatccttggctctcccactccagatgacctg
aactgcatcatcaacatgaaggccaggaactacctgcagtctctgcctgagaaacccaag
atcccttggaacaagctgttccccaaggcggacagcaaggctctggacctgctgggccgc
atgttgacctttaaccctatcaagcgcatcacggtagaggaggccctggctcatccctat
ctggagcagtactacgaccccactgacgagcctgtagcagaggagccgttcaccttcacc
atggagctggatgacctgcctaaggagaagctgaaggagctcatctttgaggagacgttc
cgcttccaggccacctaccagggctcctga

DBGET integrated database retrieval system