KEGG   Salmo salar (Atlantic salmon): 100380532
Entry
100380532         CDS       T04363                                 

Gene name
sta5b
Definition
(RefSeq) Signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100380532 (sta5b)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100380532 (sta5b)
Transcription factors [BR:sasa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100380532 (sta5b)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2 NHR2 Prominin
Other DBs
NCBI-GeneID: 100380532
NCBI-ProteinID: NP_001167288
UniProt: C0HB67
LinkDB
Position
ssa03
AA seq 784 aa
MAVWIQAQQLQGDALHQMQSLYGQHFPIEVRHYLSQWLEGQLWDVIDLENPQEEFKAKRL
LDSLIQELQNKAEHQVGEDGFLLKIKLGHYASQLKSTYDRCPLELVRCIKHILYTEQRLV
REASNSSSPVGGMMDSMSQKYQQINQAFEELRLLTQDTENDLRKLQHNQEYFIIQYQESL
RIQAQLTSLATLPPADRQLREPTLLSKRATVEAWLTREANTLQKYRLDLAEKHQKSLQLL
RKQQTIILDDELIHWKRRQQLAGNGGPPEGGLDILQSWCEKLAETIWQNRQQIRRAEHLR
QQLPIPGPIEELLNDLNSTITDIISALVTSTFIIEKQPPQVLKTQTKFVATVRLLVGGKL
NVHMNPPQVKATIISEQQAKALLKNENTRNDSSGEILNNNCVMEYHQATGTLSANFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFIVPDKVLWPQLCEALNMKYKAEVQSNRGLSEENLVFLAQKAFSS
SSINPDDYRGMTMTWSQFNRESLPGRNFTFWQWFDGVMELTKKHLKPHWNDGAILGFVNK
QQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKPGERMVWNLMPYTAKDFSIRSL
ADRISDLNHLLFLYPDRPKDEVFSKYYTPPLSKAVDGYVKPQIKQVVPEFTTTNPDPAAN
PTYMDHGASPVVSHPPNYGIYPPMSDSMLDADGDFDLDDTMDVARHVEELLRRPMESQWS
GQQS
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggcagtgtggatccaggcccagcagctccagggggatgcgctgcaccagatgcagtct
ctctatggacagcacttccccatcgaggtgcgccattacctgtcccagtggctcgagggc
caactctgggatgtgatcgatctggagaacccccaggaggagtttaaggccaagcgtctg
ctggacagcttgatccaggagctgcagaacaaggctgagcatcaggtgggagaggacggc
ttcctgctcaagatcaaactgggacactacgccagccagctcaagagcacgtatgaccgc
tgccctctggagctggtgagatgcatcaaacacatcctgtacacggagcagaggctagtc
cgagaggcctctaattcaagctccccagtgggcgggatgatggacagcatgtcccagaag
taccagcagatcaaccaggcatttgaggagctgcgcctgctgacccaggacacagagaac
gacctgagaaagctccagcacaaccaggagtacttcatcatccagtaccaggagagcctc
cgcatccaggcccagttgaccagcctggccacactgccccctgctgacagacagctgagg
gagcccacattactgagcaagagagccaccgtggaggcctggctcacccgggaggccaac
acactacagaaatacagactggacctggcagagaagcaccagaagagcctgcagctgctg
aggaagcagcagaccatcatcctggatgacgagctgatccactggaagagacgtcaacag
ctggccggcaacgggggtcctccagagggggggctggacatcctgcagtcctggtgtgag
aagttggcagagacgatctggcagaacaggcagcagatcaggagagcagaacacctgaga
caacagcttcccatccccggccccatcgaggagctactgaacgacctcaacagcaccatc
acagacatcatctcagcactggtcaccagcacctttatcatagagaagcagcctccccag
gtgctgaaaacccagaccaagtttgtcgccacagtgcgcctcctagtgggcgggaagctc
aatgtgcacatgaaccccccgcaggtcaaggccaccatcatcagtgaacagcaggcgaag
gccttgctcaagaacgagaacaccaggaatgacagcagtggagagatccttaacaacaac
tgtgtgatggagtaccaccaggccacaggaacactcagtgccaacttcaggaacatgtct
ttgaagaggatcaagcgctcggaccggcgaggggcggagtctgtgacagaggagaagttt
accattctgtttgaatctcagtttagcgtcgggggtaatgagctggtctttcaggttaag
acgttatcacttcctgtggtggtgattgtccatggtagccaagacaataacgccacagca
acagtgctgtgggacaacgcttttgccgaacccggtcgggtgcccttcatagtgcctgac
aaggtgctgtggccccagctgtgtgaggccctcaacatgaagtacaaggcggaggtgcag
agtaaccgtggcctctcagaggagaacctggtcttcctggcccagaaagccttcagtagc
tccagcatcaaccctgatgactaccgcggcatgaccatgacctggtcccagttcaacagg
gagagtctgcctggcaggaatttcacgttctggcagtggtttgatggggtcatggaactc
acaaaaaaacatctcaaaccacactggaatgatggggcgatcctgggatttgtgaacaag
cagcaggctcaggacatgttgatgtccaaacccaacgggaccttcctgctccgcttcagc
gactctgagatcggagggatcactatcgcctgggtggctgagaaccccaacaaaccaggg
gagagaatggtgtggaacctcatgccctacacagccaaagacttctccatccgctctctg
gctgaccgcatcagtgacctcaaccacctcctcttcctctacccagacagacctaaggat
gaggtcttctccaaatactacacgccacccctgtccaaagcagtggatggatacgtgaaa
ccgcagatcaaacaagtggtaccagagttcaccacgaccaatcctgacccagcagcaaac
cccacctacatggatcacggagcctcccctgttgtcagtcaccctccaaactacggcata
tacccgcctatgagtgactccatgttagatgcggacggtgactttgacctggatgacacc
atggacgtggcgcgacacgttgaggagctgctgcggcgaccgatggagagccaatggagc
ggccagcagtcgtga

KEGG   Salmo salar (Atlantic salmon): 106579144
Entry
106579144         CDS       T04363                                 

Definition
(RefSeq) signal transducer and activator of transcription 5B-like
  KO
K11224  signal transducer and activator of transcription 5B
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106579144
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106579144
Transcription factors [BR:sasa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    106579144
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2 STATa_Ig TMEM215
Other DBs
NCBI-GeneID: 106579144
NCBI-ProteinID: XP_014014218
UniProt: A0A1S3NFI8
LinkDB
Position
ssa19
AA seq 788 aa
MAVWIQAQQLQGDALHQMQSLYGQHFPIEVRHYLAQWIEGQLWDSVELENPQDELKAKRL
LDSLVQELQRKAEHQVGEDGFLLKIKLGHYAGQLKSTYDRCPLELVRCIKHILHSEQRLV
QEATNAVGSSGGGGTMDSLSQRHQQINQTFEELRVSTQETENELRKLQHNQEYFIIQYQE
NLRIQAQLSSLSAVPAEERTQRETSLQAKRATVEAWLTREANTLQKYRLDLAEKHQKTLG
QLRKQQTLILDEELIQWKRRQQLAGNGGPTEGGLDVLQSWCEKLADLIWQNRQQIRRAEH
LTQQLPLPGPMEELLTKLNSDITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGG
KLNVHMNPPQVKAVIVSEQQAKALLKNESTRNDSSGEILNNNCVMEYHRTTGTLSAHFRN
MSLKRIKRSDRRGAESVTEEKFTVMFESQFSVGGNELVFHVKTLSLPVVVIVHGSQDNNA
TATVLWDNAFAEPGRVPFIVPDKVLWPQLCEALDMKYKAEMHSARGLCDDNLIFLAQKAF
SSASINPEDYRNMTMSWAQFNRESLPGRNFTFWQWFDGVMELMKKHLKPHWNDGAILGFV
NKQQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKAGERLVWNLMPYTTKDFSIR
SLADRISDLNHLMFLYPDRPKDEVFSKYYTPPLSKAVDGYVKPQIKQVVPEFTTPNPEPS
SGNPTYMDQAPSPSVAHPINFAIFPPIRSDPMMDADGEFDLEDTMDVARHVEELLRRPMA
NQWDGQQS
NT seq 2367 nt   +upstreamnt  +downstreamnt
atggcggtgtggatccaggcccagcagttgcagggggatgcgctgcaccagatgcagtcg
ctctacggacagcacttccccatagaggtgcgccactacctggcccagtggatcgagggg
cagctctgggattctgtggagctggagaacccccaggatgagctgaaggccaagcgtctg
ctggacagcctggtgcaggagctgcagaggaaggccgagcaccaagtgggggaggacggc
ttcctgctcaagatcaaactgggacactacgccggccagctcaagagcacgtatgaccgc
tgtcctcttgagctggtgcgctgcatcaagcacatccttcactcggagcagaggctggtg
caggaggccaccaacgccgtcgggagcagcggtgggggcgggaccatggacagcctgtcc
cagaggcaccagcagatcaaccagacgttcgaggagctgcgcgtgtccacgcaggagact
gagaacgagctgcgcaagctgcagcacaaccaggagtatttcatcatccagtaccaggag
aacctgcgcatccaggcccagttgagcagtctgtcggccgtgccggcagaagagcgaacc
cagagggagaccagcctgcaggccaagagagccaccgtggaggcttggctcaccagggag
gccaacacactgcagaaatacagactggacctggcggagaagcaccagaagactctgggc
cagctgaggaagcagcagacgctgatcctggatgaggagctgatccagtggaagagacgt
cagcagctggccggcaacggggggcccaccgaggggggactggatgtcttgcagtcctgg
tgtgaaaagctggcggacctgatctggcagaaccggcagcagatccggcgggccgaacac
ctgacccagcagctacctctgcctggcccaatggaggagctgctcaccaagctcaactct
gacatcaccgacatcatctccgccctcgtcaccagtacgtttatcatcgagaagcagccg
ccccaggtgctgaagacccagactaagtttgcggctactgtgcgcctactggtgggcggg
aagctcaacgtgcacatgaaccccccgcaggtcaaggcagtcatcgtcagcgagcagcag
gccaaggcccttctcaagaatgagagcacccgcaatgacagcagtggagaaattctcaac
aacaactgtgtgatggaataccaccggaccacaggaaccctgagtgctcacttcaggaac
atgtccctgaagcggatcaaacggtcggaccgtcgcggggcagagtcggtcacagaggag
aagttcactgtcatgtttgagtctcagttcagcgtggggggcaacgagctggtgttccac
gtcaagacattatctctccccgtggtggtgatagttcacggtagtcaagacaacaacgcc
acggcaacggtcctgtgggacaacgcttttgcagagccgggcagggtgccattcatagtt
cctgacaaggtgctgtggccccagctgtgtgaagccctagacatgaaatacaaggcagag
atgcacagtgcccgtggcctctgcgacgacaacctgatcttcctggcccagaaggcattc
agcagcgccagcataaacccagaagactaccgcaacatgaccatgtcctgggcccagttc
aaccgggagagcttgcctggaaggaacttcactttctggcagtggtttgacggagtcatg
gagctcatgaagaaacacctgaagccccactggaatgacggggcgatcttgggctttgtg
aacaaacagcaagcccaggatatgctgatgtccaagcccaacgggaccttcctgctccgc
ttcagtgactctgagatcgggggcatcaccatcgcctgggtggcagagaaccctaacaaa
gcaggggagaggctggtgtggaacctcatgccgtacaccaccaaagacttttctatccgc
tcactagccgaccgcatcagtgacctcaaccacctcatgttcctctatcccgaccggccc
aaagacgaggtgttctccaagtactacacccctcccctctcaaaagcagtggatggctac
gtcaaaccacagatcaagcaggttgttccagaattcactactcccaaccctgagccgtcc
agtgggaaccccacctacatggaccaggcaccctccccgtcagtggctcaccccatcaac
tttgcaattttccctcccatcagaagtgaccccatgatggacgcagatggagagtttgac
ctggaagacaccatggatgtggcccgacatgtggaggagcttctgcggcggcccatggcc
aaccagtgggacggccaacagtcctga

KEGG   Salmo salar (Atlantic salmon): 106607295
Entry
106607295         CDS       T04363                                 

Definition
(RefSeq) signal transducer and activator of transcription 5B-like
  KO
K11224  signal transducer and activator of transcription 5B
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106607295
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106607295
Transcription factors [BR:sasa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    106607295
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2 Prominin NHR2
Other DBs
NCBI-GeneID: 106607295
NCBI-ProteinID: XP_014059588
UniProt: A0A1S3S5G2
LinkDB
Position
ssa06
AA seq 784 aa
MAVWIQAQQLQGDALHQMQSLYGQHFPIEVRHYLSQWLEGQLWDVIDLENPQEEFKAKRL
LDSLIQELQNKAEHQVGEDGFLLKIKLGHYASQLKSTYDRCPLELVRCIKHILYTEQRLV
REASNSSSPVGGMMDSMSQKYQQINQAFEELRLLTQDTENDLRKLQHNQEYFIIQYQESL
RIQAQLTSLATLPPADRQLREPTLLSKRATVEAWLTREANTLQKYRLDLAEKHQKSLQLL
RKQQTIILDDELIHWKRRQQLAGNGGPPEGGLDILQSWCEKLAETIWQNRQQIRRAEHLR
QQLPIPGPIEELLNDLNSTITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKALLKNENTRNDSSGEILNNNCVMEYHQATGTLSANFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFIVPDKVLWPQLCEALNMKYKAEVQSNRGLSEENLVFLAQKAFSS
SSINPDDYRGMTMTWSQFNRESLPGRNFTFWQWFDGVMELTKKHLKPHWNDGAILGFVNK
QQAQDMLMSKPNGTFLLRFSDSEIGGITIAWVAENPNKPGERMVWNLMPYTTKDFSIRSL
ADRISDLNHLLFLYPDRPKDEVFSKYYTPPLSKAVDGYVKPQIKQVVPEFTTTNPDPAAN
PTYMDHGASPVVSHPPNYGIYQPMSDSMLDADGDFDLDDTMDVARHVEELLRRPMENQWR
GQQS
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggcagtgtggatccaggcccagcagctccagggggatgcgctgcaccagatgcagtct
ctctatggacagcacttccccatcgaggtgcgccattacctgtcccagtggctcgagggc
caactctgggatgtgatcgatctggagaacccccaggaggagtttaaggccaagcgtctg
ctggacagcctgatccaggagctgcagaacaaggctgagcatcaggtgggagaggacggc
ttcctgctcaagatcaaactgggacactacgccagccagctcaagagcacgtatgaccgc
tgccctctggagctggtgagatgcatcaaacacatcctgtacacggagcagaggctagtc
cgagaggcctctaattcgagctccccagtgggcgggatgatggacagcatgtcccagaag
taccagcagatcaaccaggcattcgaggagctgcgcctgctgacccaggacacagagaac
gacctgagaaagctccagcacaaccaggagtacttcatcatccagtaccaggagagcctc
cgcatccaggcccagttgaccagcctggccacactgccccctgctgacagacagctaagg
gagcccacattactgagcaagagagccaccgtggaggcctggctcacacgggaagccaac
acactacagaaatacagactggacctggcagagaagcaccagaagagcctgcagctgctg
aggaagcagcagaccatcatcctggatgacgagctgatccactggaagagacggcaacag
ctggccggcaacgggggtcctccggagggggggctggacatcttgcagtcctggtgtgag
aagttagcagagaccatctggcagaacaggcagcagatcaggagagcagaacacctgaga
caacagcttcccatccccggccccatcgaggagctactgaacgacctcaacagcaccatc
acagacatcatctcagcactggtcaccagcacctttatcatagagaagcagcctccccag
gtgctgaagacccagaccaagtttgccgccacagtgcgcctcctagtgggcggaaagctc
aatgtgcacatgaaccccccgcaggtcaaggccaccatcatcagtgaacagcaggcgaag
gccttgcttaagaatgagaacaccaggaacgacagcagtggagagatccttaacaacaac
tgtgtgatggagtaccaccaggccacaggaacactcagcgccaacttcaggaacatgtct
ttgaagaggatcaagcgctcggaccggcgaggggcggagtctgtgacagaggagaagttt
actattctgtttgagtctcagttcagcgtcgggggtaatgagctggtctttcaggttaag
acgttatcacttcctgtggtggtgatcgtccacggtagccaagacaataacgccacggca
acagtactgtgggacaacgcttttgccgaacccggtcgggtgcccttcatagtgcctgac
aaggtactgtggccccagctgtgtgaggccctcaacatgaagtacaaggcggaggtgcag
agtaaccgtggcctctcagaggagaacctggtcttcctggcccagaaagccttcagtagc
tccagcatcaaccctgatgactaccgcggcatgaccatgacctggtcccagttcaacagg
gagagtctgcctggcaggaatttcacgttctggcagtggtttgatggggtcatggaactc
acaaaaaaacatctcaaaccacactggaatgatggggcgatcctgggatttgtgaacaag
cagcaggcccaggacatgttgatgtccaaacccaacgggaccttcctgctccgcttcagc
gactctgagatcggagggatcactatcgcctgggtggctgagaatcccaacaaaccaggg
gagaggatggtgtggaacctcatgccctacacaaccaaagacttctccatccgctctctg
gctgaccgcatcagtgacctcaaccacctcctgttcctctacccagacagacccaaggat
gaggtcttctccaaatactacacgccacccctgtccaaagcagtggatggatatgtgaaa
ccgcagatcaaacaagtggtaccagagttcaccacaaccaatcctgacccagcagcaaac
cccacctacatggatcacggagcctcccctgttgtcagtcaccctccaaactacggcata
taccagcctatgagtgactccatgttagatgcggacggtgactttgacctggatgacacc
atggacgtggcgcgacacgttgaggagctgctgcggcgacctatggagaaccaatggaga
ggccagcagtcgtga

DBGET integrated database retrieval system