KEGG   Salmo salar (Atlantic salmon): 100380730Help
Entry
100380730         CDS       T04363                                 

Gene name
ogt1
Definition
(RefSeq) UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
  KO
K09667  protein O-GlcNAc transferase [EC:2.4.1.255]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    100380730 (ogt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sasa01003]
    100380730 (ogt1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sasa03036]
    100380730 (ogt1)
Enzymes [BR:sasa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     100380730 (ogt1)
Glycosyltransferases [BR:sasa01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   100380730 (ogt1)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     100380730 (ogt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_41 TPR_1 TPR_11 TPR_2 TPR_17 TPR_8 TPR_14 TPR_12 TPR_19 TPR_16 TPR_7 TPR_10 TPR_9 TPR_6 NARP1 TPR_MalT TPR_15 FAT MIT TPR_21 SNAP Wzy_C_2 EST1_DNA_bind BTAD ANAPC3 Tcf25
Motif
Other DBs
NCBI-GeneID: 100380730
NCBI-ProteinID: XP_014068634
UniProt: A0A1S3SWB9
LinkDB All DBs
Position
ssa09
AA seq 1060 aa AA seqDB search
MASSVGNVADSTEPTKQRMLSFQGLAELAHREYQSGDFEAAERHCMQLWRQEPDNTGVLL
LLSSIHFQCRRLDRSAHFSTLAIKQNSMLAEAYSNLGNVYKERGQLQEAIEHYRHALRLK
PDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLYCVRSDLGNLLKALGRLEEAKAC
YLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEAR
IFDRAVAGYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNL
ANALKEKGNVRKNTVSEAEECYNTALRLCPTHADSLNNLANIKREQGNIEDAVQLYRKAL
EVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQDVQGA
LQCYTRAIQINPAFADAHSNLASIHKDSGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQ
IVCDWTDYDERMKKLVSIVADQLDKNRLPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDK
VQALIKINALHKPAFEYPKDLKASAGRLRVGYVSSDFGNHPTSHLMQSIPGMHNSDKFEV
FCYALSPDDNTNFRVKVVAEAHHFTDLSQLPCNGKAADRIHQDGLHILVNMNGYTKGARN
ELFALRPAPIQCMWLGYPGTSGAPFMDYIVSDKETSPFEVAEQYSEKLAYMPHTFFIGDH
ANMFPHLKKKAVIDFKSNGHIFDNRIVLNGIDLKAFLDSLPDVKVVKMKCSIGESGAAET
NGALSMPVIPMNTAAEAIINMINQGQIQVTINGFTVSNGLATTQLNNKAATGEEVPRTIV
VTTRSQYGLPEDSIVYCNFNQLYKIDPPTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQ
YAQNFGLPGSRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPG
ETLASRVAASQLQCLGCPELIAHTRQEYEDVAVKLGCDMEYLKMIRSRVWKQRICSPLFN
TKQYTMDLEKLYLQMWERHASGGKPDHLVKLQPVESSESA
NT seq 3183 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctccgtgggaaacgtggctgacagcacagaaccgacaaaacaacgtatgctt
tccttccaagggttggccgagctggcgcaccgggagtaccagtcgggtgactttgaggct
gccgagcgccactgtatgcagctgtggaggcaggagcccgacaacacgggcgtgctgctg
ttgctctcctccatccacttccagtgtcgcaggctcgacagatctgcccacttcagcacc
ttggccatcaagcagaattctatgctggctgaggcctactccaacctgggcaacgtttac
aaggagcgcggccagttgcaggaggctatagagcactaccgccatgcgctgcggctgaaa
ccagacttcatcgatgggtacatcaacctggcagcagccctggtggcagcgggggacatg
gagggagccgtccaggcctatgtatcagccctacagtacaaccctgatctgtactgtgtc
cgcagcgacctggggaacttgctcaaagccctggggcgtttggaagaggctaaggcgtgt
tacctgaaggctattgagactcagcctaactttgcggtggcttggagcaacctaggttgt
gtgttcaacgcccagggagagatatggttggccatacaccactttgagaaggctgtgact
ctggatcccaacttcctggatgcctacatcaacttgggcaacgttctgaaagaggctcgc
atctttgacagagcggtggctggctacctgcgtgccctcagcctgagccccaaccatgcc
gtcgtccacggcaacctggcgtgcgtctactacgagcagggtcttatcgacctggccatt
gacacgtaccgccgcgccatcgagctgcagccccacttccctgacgcctactgtaacctg
gccaacgccctcaaggagaagggcaatgtaaggaagaacacggtatccgaggctgaggag
tgttacaacacggctctgcggctgtgtcccacccacgcagactctctcaacaacctggcc
aacatcaagagggagcagggcaacatcgaggacgccgtccagctctacaggaaagccctg
gaggtgtttccagagtttgctgcggcccactctaacctggccagtgttctgcagcagcaa
gggaaactccaggaggccctcatgcactacaaggaggccatcagaatcagccctacgttt
gctgatgcctactccaacatgggcaacactctgaaagagatgcaggatgtccagggagct
ctacagtgttacaccagagccatccagatcaaccctgccttcgctgatgctcactctaac
ctggcctccatacacaaggactctggtaacatcccagaagccattgcttcataccgtaca
gccctgaaactgaagcctgacttccctgatgcctactgcaacctagcacactgcttgcag
attgtgtgtgactggacagactatgatgagcgtatgaagaagctggtgagcatcgtggct
gaccagttggataagaaccggctgccctcggtgcacccccaccacagcatgctgtacccc
ctctcgcacggcttccgcaaggccatcgctgagaggcacggcaacctctgtctggacaag
gtacaggccctcatcaaaatcaatgcgctccacaagccggcctttgagtaccccaaggac
ctgaaggccagcgcgggtcgtctgagggtgggatatgtcagctctgacttcgggaaccac
cccacctcccacctcatgcagtccatccccggcatgcacaactctgacaagtttgaggtg
ttctgctatgcactgagtccagatgacaacaccaactttagggttaaagtggtggccgag
gcacatcacttcactgacctgtcacagctcccgtgtaatggtaaggcagcagacaggatc
catcaggatggactccacatcctggtcaatatgaacggctataccaaaggagcccgcaac
gagctgtttgccctgcgccctgctcccatccagtgtatgtggctgggctacccagggacc
agcggagctcccttcatggactacattgtgtcagacaaggagacgtcccccttcgaggtg
gcagagcagtactctgagaaactagcctacatgccacacaccttcttcattggagaccac
gctaacatgtttccccacctcaagaaaaaggcggtgattgacttcaagtctaacggccac
atctttgacaaccgcatcgttctgaatggcattgacctcaaggccttcctggacagcctg
cctgacgtcaaggtggtcaagatgaagtgttccattggggagagtggcgcagcagaaacc
aacggggctctgtccatgcccgtcatccccatgaacacagcagctgaggccatcatcaac
atgatcaaccagggacagatacaggtcaccatcaatggattcaccgtcagcaatggactg
gccaccacacagctcaacaacaaggcggctacaggagaggaggttcctcgtaccatcgtg
gtgacaacccgctcccagtacggcctgcctgaagactccatcgtctactgcaacttcaac
cagctctacaagatcgaccctcccaccctgcagatgtgggccaatatcctgaagcgtgtt
cccaacagtgttctgtggttactgcgtttccctgcagtgggtgagcccaacatccaacag
tacgcccagaacttcggcctgcccggctcccgcatcatcttctctcccgtggcgcccaag
gaggaacatgtgagacggggccagctggccgacgtgtgtctggacacgccactctgtaac
ggacacaccaccggcatggacgtcctctgggccgggacacccatggttacaatgccaggt
gagactctggcgtcacgcgtggcagcctctcagctgcagtgtctgggttgtcctgagctc
atcgcccacaccagacaggaatatgaggacgtggctgtcaaactgggctgtgacatggaa
tatctgaagatgatccggtcccgtgtgtggaagcagcgtatctgcagccctctgttcaac
accaagcagtacactatggatctggagaagctctacctgcagatgtgggagcgccacgcc
agcggcggcaagccagaccacctggtcaaactgcagcccgttgagagcagcgagagcgcc
tga

DBGET integrated database retrieval system