KEGG   Salmo salar (Atlantic salmon): 100380732
Entry
100380732         CDS       T04363                                 

Gene name
gab1
Definition
(RefSeq) GRB2-associated-binding protein 1
  KO
K09593  GRB2-associated-binding protein 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100380732 (gab1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    100380732 (gab1)
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   100380732 (gab1)
SSDB
Motif
Pfam: PH PH_11 PH_13 zf-piccolo
Other DBs
NCBI-GeneID: 100380732
NCBI-ProteinID: XP_014064938
UniProt: A0A1S3SKS4
LinkDB
Position
ssa08
AA seq 789 aa
MSGGDVVCSGWLRKSPPEKKLRRYAWKKRWFVLRSGRLSGDPDVLEYYKNDHAKKPIRVI
DLNLCEQVDAGLTFNKKDLEHSFIFDIKTIDRVFYLVADTEDDMNKWVRYICDICGFNPT
DDEAAKAAHQAASSGSVVDTPPHPGLGGPPAMLTNVPPPYQPVSVRHLDSESSLDEPQDY
LWLVNCESKKPEPNSSVTPLPQEYLLLEECESKGASSPPQVKQAHAECSKSTSSETDLND
NVPAHRTPTSTSSSSKHANGFFSSVLPPHPSSASSIYDSPPSRGGDLSSSLYHLPRSYSQ
DTVLLPKSASASSPPVPVDGDAPELYVFNAPSRKPSMETQMRNLSVSYDIPPTPGSNCTY
QVPRGPASGGSEGGDGMPPPRPPKPSLSTLTPGHPPPPAERSPTDTYCVPRSMSETDGNY
CVPTSAGNKALRSNTIGTMDSSRLRKDLGSQDCYDIPRTFPSDKSCSFDFNESFNSYLPA
SLSAPPPLQKNKGMMPVGSQSMEEVDQNYVPMSANSPSHHRSGSLSGCEPIMEPNYVPMT
PGPGTLEFSLGKQVPPPAHMGFRSSPNTPPRRPMLISDCQPPPVDRNLKPDRKGQSPKII
RAKGVGLERTDSQTVGEFPRRRKAKPAPLEIKPLPEWEESSAPVRSPVTRSFARDPSRFP
MPPRPPSVHSTASSTDSEDCDENYVAMVSKADELNMKLGAPMTADGGSSPMVKPKGDKQV
EYLDLDLDPGKSTPPRKKKSNGIGLAVSDERVDYVVVDQQRTQALKSTREAWNDGRQSTE
TDTSTKGPK
NT seq 2370 nt   +upstreamnt  +downstreamnt
atgagcgggggagatgtggtgtgctcgggctggttaagaaaatctcctccagaaaaaaag
ttgagacgttacgcatggaagaagcggtggtttgttctccgcagcggccgtctctcgggc
gacccagacgtgctggagtactacaagaatgaccacgccaagaagcccatccgcgtgatc
gacctcaacctgtgtgaacaggtggacgcagggctcacgttcaacaagaaggacctggag
cacagcttcatcttcgacatcaagaccatcgaccgcgtcttctacctggtggccgacacg
gaggacgacatgaacaagtgggtccgctacatctgtgacatctgcggcttcaaccccacg
gacgacgaagcggcaaaggccgcccaccaggcggccagcagtggctctgtggtggacacc
ccccctcaccctggcctggggggtcctccggccatgctgaccaacgtgccccctccctac
cagccggtcagcgtgcgccacctggactcagagtccagcctggacgaaccccaggactac
ctgtggctggtcaactgtgagagcaagaagccagagcccaacagctctgtgactcctctc
ccccaggagtacctcctcctggaggagtgtgagagcaaaggggcttcttctcctccccag
gttaagcaagcccacgccgagtgttccaagtcgacctcgtcggagacggacctgaacgac
aacgtccccgcccaccgcacgccaacctccactagctcctcctctaagcacgccaacggc
ttcttctcctctgtcctgccccctcacccctcctccgcctcctccatctatgactctccg
ccttcccgcggaggcgacctctcctccagcctctaccacctcccccgctcctactcccag
gacactgtgctccttcccaagtcggcctccgcctcctcgccccccgtcccggtcgacggc
gacgccccggagctctacgtcttcaacgcgccctcgcggaagccctccatggagactcag
atgaggaacctgtcggttagctacgatattcctcccacaccaggcagtaactgtacctat
caggtgcctcggggtccagcgagtggtgggtctgagggtggggatgggatgcctccgccc
cggccccccaagccttccctcagcaccctgaccccggggcacccgccgccccccgcggag
cgctcgcccacggacacgtactgcgtgccgcgctccatgtcggagacggacgggaactac
tgcgtgcccaccagcgccgggaacaaggccctgaggagcaacaccatcggcaccatggac
tcatcacgcctcaggaaagatttgggctcccaggactgttacgatatccccaggacgttt
ccctctgacaagagctgctcgtttgacttcaacgaaagcttcaacagctacttgcctgcc
tctctctctgcaccccctcccctccagaaaaacaaaggcatgatgccagtgggcagccag
tccatggaggaagttgaccagaactacgtacccatgagcgccaactccccgtcccaccac
cgctccggcagcctgtcgggctgtgaacccatcatggaacccaactatgtccccatgacc
ccgggcccgggcaccttagagttctccctgggcaagcaggttcccccgccggcccacatg
gggtttcgctcaagccccaataccccaccccgcaggcccatgctcatcagcgattgtcag
cccccgcccgtggaccgcaacctcaaaccggaccgcaaaggtcagagtcctaaaataata
agagcaaagggggttggtttagagcgaaccgactctcagaccgtaggggagttcccaaga
cgacgcaaggccaagcccgcccctttggagatcaagcccctacctgagtgggaggagtca
tcagcgcctgtccgctcgcctgtcaccaggtcttttgctcgggatccctccaggttcccc
atgccccccaggcctccctcggtgcatagcaccgcctccagcaccgactccgaggactgt
gatgagaattatgtagccatggtctctaaggcagacgaactaaacatgaagctgggtgcg
cctatgacggcggacggggggagcagcccaatggtgaagcccaaaggagacaagcaggtg
gagtacctggacctagacctggaccccggcaagtctaccccaccacggaagaagaagagt
aatgggattggtctggcagtgtcagatgagcgggtggactacgtggtggtggaccagcag
cggacacaggccctcaagagcacccgggaggcctggaacgacggacgccagtccacagag
acagacacctccaccaaagggcccaagtga

KEGG   Salmo salar (Atlantic salmon): 106578202
Entry
106578202         CDS       T04363                                 

Gene name
gab1
Definition
(RefSeq) GRB2 associated binding protein 1
  KO
K09593  GRB2-associated-binding protein 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106578202 (gab1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    106578202 (gab1)
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   106578202 (gab1)
SSDB
Other DBs
NCBI-GeneID: 106578202
NCBI-ProteinID: XP_014012318
UniProt: A0A1S3NA23
LinkDB
Position
ssa18
AA seq 719 aa
MGRVQIRGRDIGARGNSLRVKTVLSINLQPFCTLSDRPTVTAQTPTVTVTTGHAPVSAAT
AIVAPPPYQPVGARHLESVSSQEEGTEYLWLSHCQSKTPHRPPVSSYHSTSSDTTDYNDN
TLPSHWPPPSSSSSCSSPSSLAKGLPPHAHASIGPRAVTTETNPFSKSQDSALTPEVHRG
WTRGHPSPHPRKHSLQLQAVSLPPICNDMVFNTSSTINTKAHSFTSNSNTTYQVPSSTPT
AGSPTPGQGDSSTPPPRPPKPLVSAPAEVSSLATLSASLHRSASEPERSYGGGRGRGGEG
QGGRGERGNNPRAPRCNTIATSGYTHTGTGSQESYAVPRSLADQTRASMSDQTRASMFEF
SDNFNSYFMNKGMVPLGGTCPGKEDVDENYVPMNTADASLVSLPPPSYPDPTSLVSLPPP
SFPDPNSLVSLPPPSFPDPNSQDPNYVIMTPCPGELPSLGRQVPPPAHLGFRSSSHNPHT
RPSRRHTTGGGGGGGAGDTQPPPIHRNLKPRKSFSPISLHPKPLGLERTDSQTVGEFTRA
RRLKVKPTPLDITPVQEWEEIPPPVRSPVTRTFTRDPSSCYTCPSDRPSTCQSSTSSSDS
DDPDDNYVAMTTSNIALAAVVSTLRGDSPMVLRRPRGDKQVEYLDLDLHTGRVATPPRQK
KSVLGGSMGSSEGERAREREGERARERVDYVVVDPERTRALKSTREAWHDGRQSTEKDK
NT seq 2160 nt   +upstreamnt  +downstreamnt
atgggtcgagtccagattagaggcagggacataggggctaggggtaattctctaagggtt
aaaaccgtactttctataaacctccagccattttgtactctttcagatagacccaccgtc
accgcccaaacccctacagtcacggtcaccacgggccacgcccccgtctccgcggcgacc
gccatcgtggcccctccgccctaccagccggtcggtgcgaggcacctggaatcagttagc
agtcaggaggagggaacagagtacctgtggctgtcacactgccagagcaagacgccacac
aggcctccagttagttcctaccactctacctcctctgacacaacagactacaatgataac
actctcccgtcccactggcctcctccctcttcttcctcctcctgttcctcaccctcctcc
ctcgctaaaggcctcccccctcacgcccacgccagcatcggccctcgggccgtcaccacg
gagaccaacccgtttagcaaatcgcaggacagcgcgttaacccctgaagtccataggggc
tggactaggggtcatccgtccccccaccccagaaaacactccctccagctgcaggctgtg
tctctccctcccatctgtaatgacatggtcttcaacacatcgagcactataaacactaaa
gcacacagtttcacttctaatagcaacacgacttaccaggtgccctcctctactcctacc
gcaggctcacccacaccaggtcagggtgactcctccacccctccaccacgcccccccaag
cccctggtctctgccccagccgaggtgtcttctctggccactctgtcggcctcactccac
cggtctgcttcagaaccagagaggagctatggaggaggacgaggtagaggaggagaagga
cagggaggaaggggagaaagaggcaacaatcccagagcacctcgttgtaacaccatagct
acctcaggctatacacacacaggcacaggttcccaggagagctatgctgtaccaaggtcc
ctcgctgaccagaccagagccagcatgtctgaccagaccagagccagcatgtttgagttt
agcgacaacttcaacagctactttatgaataaaggcatggtaccattaggtggaacgtgt
ccaggaaaggaagatgtcgatgagaactatgttcccatgaacactgccgacgcctccctc
gtctccttacctcccccctcctaccccgaccccacctccctcgtctccttacctcccccc
tccttccccgaccccaactccctcgtctccttacctcccccctccttccccgaccccaac
tcccaggaccccaactacgtcattatgacaccatgccctggagaattgccttctctgggg
agacaggtacccccgcctgcacacctgggtttccgctcctcctcccacaacccccacaca
cgcccatctcgcagacacaccaccgggggaggaggagggggaggagcgggagacacccaa
ccaccacccattcaccgcaacctcaaaccccggaaaagtttcagccccatctccctccac
ccaaaacccctgggcttggagaggactgactcacagactgttggagagttcacacgggca
aggagacttaaggttaaacccacccctctggacataacacctgtgcaggagtgggaggag
ataccgccacctgtacgatcacctgtcaccagaaccttcacccgggatccatccagctgc
tacacgtgtccgtccgatagaccctctacctgccaaagctccacctccagctcagactcg
gacgacccagacgacaactacgttgccatgacaacatccaacatcgccctcgccgccgtc
gtgtcgaccctgcgtggggacagccccatggtcttacggaggcctagaggggacaaacag
gttgagtacctggatctggacctacacactggtagagtggccacacccccacgacagaaa
aagagtgtgttgggtggctcgatgggctcgagcgaaggtgagcgtgcacgtgagcgtgaa
ggtgagcgtgcacgtgagcgtgtggactatgtggtcgttgatcctgagagaaccagagct
ctgaaaagtaccagggaggcgtggcacgacgggagacagtctactgagaaggacaaataa

KEGG   Salmo salar (Atlantic salmon): 106602350
Entry
106602350         CDS       T04363                                 

Definition
(RefSeq) GRB2-associated-binding protein 1-like
  KO
K09593  GRB2-associated-binding protein 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106602350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:sasa04990]
    106602350
Domain-containing proteins not elsewhere classified [BR:sasa04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   106602350
SSDB
Motif
Pfam: PH PH_11 PH_13 zf-piccolo
Other DBs
NCBI-GeneID: 106602350
NCBI-ProteinID: XP_014050404
UniProt: A0A1S3RF39
LinkDB
Position
ssa04
AA seq 783 aa
MVQTTGLFVQSWEQVSKAESVWSLCISTCEIVLEGVQDQFRGEVSKAWKKRWFVLRSGRL
SGDPDVLEYYKNDHAKKPIRVIDLNLCEQVDAGLTFNKKDLEHSFIFDIKTIDRVFYLVA
DTEDDMNKWVRYICDICGFNPTDDEAAKAAHQAASSGSVVDTPPHPGLGGPPAMLTNVPP
PYQPVSVRHLDSESSLDEPQDYLWLVNCESKKPEPNRAHAECSKSTSSETDLNDNVPAHR
TPTSTSSSSKHANGFFSSVLPPHPSSASSIYDSPPSRGGDLSSSLYHLPRSYSQDTVLLP
KSASASSPPVPVDGDAPELYVFNAPSRKPSMETQMRNLSVSYDIPPTPGSNCTYQVPRGP
ASGGSEGGDGMPPPRPPKPSLSSLTPGHPPPPAERSPTDTYCVPRSMSETDGNYCVPTSA
GNKALRSNTIGTMDSSRLRKDLASQDCYDIPRTFPSDKSCSFDFNESFNSYLPASLSAPP
PLQKNKGMMPVGSQSMEEVDQNYVPMSANSPSHHRSGSLSGCEPIMEPNYVPMTPGPGTL
EFSLGKQVPPPAHMGFRSSPNTPPRRPMLISDCQPPPVDRNLKPDRKGQSPKIIRAKGVG
LERTDSQTVGEFPRRRKAKPAPLEIKPLPEWEESSAPVRSPVTRSFARDPSRFPMPPRPP
SVHSTASSTDSEDCDENYVAMVSKADELNMKLGAPMTADGGSSPMVKPKGDKQVEYLDLD
LDPGKSTPPRKKKSNGIGLAVSDERVDYVVVDQQRTQALKSTREAWNDGRQSTETDSSTK
GPK
NT seq 2352 nt   +upstreamnt  +downstreamnt
atggtccagaccactggattgtttgtgcagtcatgggaacaagtctctaaagctgagagt
gtatggagcctgtgtataagcacatgtgaaatcgtcctggaaggagttcaggaccagttc
cgaggcgaagtgagcaaggcatggaagaagcggtggtttgttctccgcagcggccgtctc
tcgggcgacccagacgtgctggagtactacaagaatgaccacgccaagaagcccatccgc
gtgatcgacctcaacctgtgtgaacaggtggacgcagggctcacgttcaacaagaaggac
ctggagcacagcttcatcttcgacatcaagaccatcgaccgcgtcttctacctggtggcc
gacacggaggacgacatgaacaagtgggtccgctacatctgtgacatctgcggcttcaac
cccacggacgacgaggcggcaaaggctgcccaccaggcggccagcagtggctctgtggtg
gacaccccccctcaccctggcctggggggtcctccggccatgctgaccaacgtgccccct
ccctaccagccggtcagcgtgcgccacctggactcagagtccagcctggacgaaccccag
gactacctgtggctggtcaactgtgagagcaagaagccagagcccaacagagcccacgcc
gagtgttccaagtcgacctcgtcggagacggacctgaacgacaacgtccccgcccaccgc
acgccaacctccactagctcctcctctaagcacgccaacggcttcttctcctctgtcctg
ccccctcacccctcctccgcctcctccatctatgactctccgccttcccgcggaggcgac
ctctcctccagcctctaccacctcccccgctcctactcccaggacactgtgctccttccc
aagtcggcctccgcctcctcgccccccgtcccggtcgacggcgacgccccggagctctac
gtcttcaacgcgccctcgcggaagccctccatggagactcagatgaggaacctgtcggtt
agctacgatattcctcccacaccaggcagtaactgtacctatcaggtgcctcggggtcca
gcgagtggtgggtctgagggtggggatgggatgcctccgccccggccccccaagccttcc
ctcagctccctgaccccggggcacccgccgccccccgcggagcgctcgcccacggacacg
tactgcgtgccgcgctccatgtcggagacggacgggaactactgcgtgcccaccagcgcc
gggaacaaggccctgaggagcaacaccatcggcaccatggactcatcacgcctcaggaaa
gatttggcctcccaggactgttacgatatccccaggacgtttccctctgacaagagctgc
tcgtttgacttcaacgaaagcttcaacagctacttgcctgcctctctctctgcaccccct
cccctccagaaaaacaaaggcatgatgccagtgggcagccagtccatggaggaagttgac
cagaactacgtacccatgagcgccaactccccatcccaccaccgctccggcagcctgtcg
ggctgtgaacccatcatggaacccaactatgtccccatgaccccgggcccgggcacctta
gagttctccctgggcaagcaggttcccccaccggcccacatggggtttcgctcaagcccc
aataccccaccccgcaggcccatgctcatcagcgattgtcagcccccgcccgtggaccgc
aacctcaaaccggaccgcaaaggtcagagtcctaaaataataagagctaagggggttggt
ttagagcgaaccgactctcagaccgtaggggagttcccaagacgacgcaaggccaagccc
gcccctttggagatcaagcccctacctgagtgggaggagtcatcggcgcccgtccgctcg
cctgtcaccaggtcttttgctcgggatccctccaggttccccatgccccccaggcctccc
tcggtgcatagcaccgcctccagcaccgactccgaggactgtgatgagaattatgtagcc
atggtctctaaggcagacgaactaaacatgaagctgggtgcgcccatgacggcggacggg
gggagcagcccaatggtgaagcccaagggtgacaagcaggtggagtacctggacctagac
ctggaccccggcaagtctaccccaccacggaagaagaagagtaatgggattggtctggca
gtgtcagatgagcgggtggactacgtggtggtggaccagcagcggacacaggccctcaag
agcacccgggaggcctggaacgacggacgccagtccacagagacagactcctccaccaaa
gggcccaagtga

DBGET integrated database retrieval system