KEGG   Salmo salar (Atlantic salmon): 100380862Help
Entry
100380862         CDS       T04363                                 

Gene name
m3k14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04210  Apoptosis
sasa04625  C-type lectin receptor signaling pathway
sasa04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100380862 (m3k14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100380862 (m3k14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100380862 (m3k14)
   04672 Intestinal immune network for IgA production
    100380862 (m3k14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    100380862 (m3k14)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100380862 (m3k14)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  Other
   100380862 (m3k14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 100380862
NCBI-ProteinID: XP_014048545
UniProt: A0A1S3R9K8
LinkDB All DBs
Position
ssa03
AA seq 873 aa AA seqDB search
MAVNQRIFNSTRPFSGSPQIELKGSYPSLPSPEDRTIDEEGKESEGDFMACLKPRLIQVL
TQGTAEQVGEAGPLNYQKNSFIAQAECETQDSQQFSPSCSERSYVGSPNCLINRDSSEHN
NVACSTAASNQDKPGSPAHCSPRKKPRKKQKRKEKKEEQRETGKQRQRRRVPSGVPEQET
QTGSSPQLIQTQEDASEPLSNISTSYSSSIPSLEAHDTRRPPYPLQDCNRGPSHSHPCWG
PQVFSPSCNLSTYGQESDSDSPLSSVGDCSLALAGLRGSVSQEDRCYAGPFCKDVERDVR
EKEGEVSETDTNEGLIFNENIQPVNYEYREGKDYSLCKCINTGSYGEVHSVQDNRTHFRF
GAKKILLKSFSSEEVGTWSALKSPRVVELFGVIREGPYVVLFMDLKAGSVGQLIKERGRL
PEDLALHYHCQVLEALEHLLKRRVLHLDIKADNVLLSEDGRDTFLCDFGHSERMDIGGQS
LSASQGDLKGTETHMAPEIVKGETRGAKADVWSSCCMLLHMLNGCQPWTRYYSRPLYFKI
ANEPPPLREIPPDCSPFTADVIKVGLQKEPTKRASASELKGRAARALREVGGLSSPIRGS
YKEPLQIDDSPSQSSQPWHPFSRDTCSEKNHKLLLESMNPGSRELNNDEEEEGSEADTEE
TTSSPDSPCSLLTQLHEWQNPKMADVTSNVSELELRKLETEFYLTSLSQLHSAETQEQLL
SCLSSSDCYSNRDLWDRKDSGRWSISPGDDLSSGVFSYNSQPDGQILSMDWLVQQSHLSP
PRCFEGVDVCITDVNGQSIRIREKRRVKVGHIATGISDQISERVFTMETQEREPVAHDEE
VQDSGLLLRCVPAPDYSQAWRWRVKEGVLETRD
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgaatcaaaggatctttaactcgaccagaccattctcagggtcaccccaaata
gagctgaaggggtcttacccaagcctccccagcccagaagacaggacgattgacgaggag
gggaaggagagcgaaggggacttcatggcttgtttaaaacccagactaattcaagtccta
acacagggcacagcagaacaagtgggtgaagcaggtccactgaactatcagaagaactcg
ttcatagcccaggctgaatgtgaaacccaagactcccagcagttcagcccttcctgctcc
gaacgctcctatgtcgggtcccccaactgcttaatcaaccgggactcatcagagcacaac
aatgtggcgtgttccaccgcagcctccaaccaggacaaaccaggctccccagcccactgc
tcccccaggaagaagccaaggaagaaacagaagaggaaggagaagaaagaggagcagagg
gagacagggaagcagagacagagacgtagagtaccttctggtgtccctgagcaggagacc
cagactggcagttctcctcaactgatccagacccaggaggacgcttcagagcccctaagt
aacatcagcacttcctacagtagcagtatcccgagtttagaggcgcatgacacaagacgc
cccccttaccccctccaggactgcaacaggggccccagccattcccacccctgctggggc
ccccaggtgtttagcccctcctgcaacctctccacctatgggcaggagagtgactcggac
tctcctctcagcagtgtgggagactgttcgttggccctagcagggctcaggggcagtgtc
agtcaggaggaccgatgctacgcaggtcccttctgcaaagacgtggaaagggatgtcagg
gagaaggagggagaagtctcagagactgacaccaacgagggcctgatcttcaatgagaat
attcagcctgtgaattatgagtacagggaggggaaggactacagcctctgcaagtgtatc
aacacagggtcatacggggaagtgcacagtgtgcaagacaacagaacacacttcagattt
ggcgccaaaaagattctcctgaagagttttagtagtgaggaagtgggtacgtggagtgcc
ctgaagtctcctcgcgtggtggaactcttcggagtgatcagagaggggccctacgtcgtc
ctcttcatggacctcaaagctggctctgtgggtcagcttattaaagagaggggtcggcta
cctgaggacctggccctgcactaccactgtcaggtcctggaggcgctggaacacctgctg
aagagacgagtgctgcatctggacataaaggcggacaatgtgttgctgtcagaggatggg
agggacacttttctgtgtgactttggacactcggagagaatggacattggtggacagagc
ctaagtgcatcccaaggagatctgaaggggacagagacacacatggccccggagattgtg
aaaggggaaacccgcggagccaaagcagacgtgtggagcagctgctgcatgttactgcac
atgctcaatggctgccagccctggacacgatactactcccgcccactgtacttcaagata
gccaatgaacccccgcctctgagggagatcccgcccgattgcagtcccttcactgctgat
gtcataaaggtgggactacagaaggagccaaccaagagggcctccgcctcggagctcaag
ggaagagcagccagagctctgagagaagtgggaggactcagcagccccatcagagggtcc
tataaggagcccctacagatagatgacagccccagccagtctagccagccctggcatccc
ttcagcagagacacctgctctgagaagaaccataagctattgctggaatccatgaaccca
gggagcagggagcttaacaatgatgaggaggaggaaggcagtgaggcagacacagaggag
acaacctcatctccagactcaccttgctctctactgacacaactccatgaatggcaaaat
cccaagatggccgacgtcacctccaatgtgtctgagcttgaactgcgcaaactggagaca
gagttctacctgaccagtctgtctcagctgcactcagcagaaacccaggagcagctactg
tcctgcctgagcagcagtgactgttactccaacagggacttatgggacagaaaggactct
ggccgttggtccatcagcccaggtgatgacctcagctctggcgtgttctcctacaacagc
caaccggatggacagattctcagtatggactggctggttcaacaaagccacctgtctcca
ccccgatgctttgagggagtggatgtctgcatcacggacgtaaatgggcaaagcatccgg
atccgagagaaacgtagggtgaaggtgggccacattgccacggggatcagcgatcagatc
tctgagagggtgttcaccatggagactcaggagcgggagccagtggcccatgatgaggag
gtgcaggactctggcctcctgctccgctgtgtccctgcacctgactacagccaggcctgg
agatggagggtcaaggagggggtgctggagactcgtgactga

DBGET integrated database retrieval system