KEGG   Salmo salar (Atlantic salmon): 101448060
Entry
101448060         CDS       T04363                                 

Gene name
igfbp-3a1
Definition
(RefSeq) insulin-like growth factor binding protein 3 paralog A1
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101448060 (igfbp-3a1)
   04218 Cellular senescence
    101448060 (igfbp-3a1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    101448060 (igfbp-3a1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    101448060 (igfbp-3a1)
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    101448060 (igfbp-3a1)
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101448060 (igfbp-3a1)
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 101448060
NCBI-ProteinID: NP_001266076
UniProt: M4Q900
LinkDB
Position
ssa10
AA seq 296 aa
MPGLCLFCLTAVLAAFTRFAETVGPVVRCEPCDAGALMECKPLPKDCAERVREPGCGCRL
SCALAEGQACGVYTGRCGSGLICQFQPGGTRPLQALLEGRGACSSAASKKLNTFLLPAQK
QENTSGEQAGAGAERRANGTMTTTTTVAVGAVGVEGGGGGHRGAIEAKPPLHTKLDVIKK
EQNKKSQSYKVESVSGGVISDMHNFSLDNKRETEYGPCRREMESILNSLKISNVLNPRGF
RIPNCDKKGFYKKKQCRPSKGRKRGYCWCVDKYGQPLPGYDGKERGEAQCYNLESK
NT seq 891 nt   +upstreamnt  +downstreamnt
atgcccggtctatgcttgttttgtctcactgcggtgctcgctgcattcacccggttcgcg
gagaccgtgggaccggtggtccgatgcgagccgtgtgacgccggggctcttatggagtgc
aagccgctgccaaaagactgcgcagagagggtgcgggagcccggctgcgggtgccgtctg
tcgtgcgcccttgctgagggtcaggcgtgtggagtgtacaccgggcgctgtggctccggg
ctgatttgtcagttccaacccggggggacccgaccgctgcaagccttgctagagggaagg
ggagcgtgctccagcgccgcgtccaaaaaactcaacacctttctgctccccgcgcagaaa
caagagaacacaagcggggagcaggccggggcgggggctgaacggcgtgccaacggcacc
atgacgacgaccacaacggtggcggtgggcgcggtaggtgtggaaggcggaggtggtgga
catcggggggcgatagaagccaaaccgccactgcacaccaagctagacgtgatcaagaag
gagcagaataagaagagccagagctacaaggtggagtcagtgtctgggggagtcatctcc
gacatgcacaacttctccctggataacaaaagggagaccgagtatggcccatgcaggaga
gagatggaaagcatcctgaacagtcttaaaatctccaatgtgctcaaccccagaggcttc
cgcatccctaactgtgacaaaaagggcttctacaagaaaaaacaatgccgtccttccaaa
gggaggaagaggggttactgctggtgtgtggataagtacggtcagcctctccctggctat
gatggaaaggagagaggagaagcccagtgttacaacctggagagcaaatga

KEGG   Salmo salar (Atlantic salmon): 101448063
Entry
101448063         CDS       T04363                                 

Gene name
igfbp-3a2
Definition
(RefSeq) insulin-like growth factor binding protein 3 paralog A2
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101448063 (igfbp-3a2)
   04218 Cellular senescence
    101448063 (igfbp-3a2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    101448063 (igfbp-3a2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    101448063 (igfbp-3a2)
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    101448063 (igfbp-3a2)
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101448063 (igfbp-3a2)
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 101448063
NCBI-ProteinID: NP_001266086
UniProt: M4Q5A5
LinkDB
Position
ssa23
AA seq 294 aa
MPGLCLFCLTAVLAAFTRFAETVGTVVRCEPCDTVALMQCKPLAKDCADSVREPGCGCCL
TCALAEGQACGVYTGRCGSGLTCQHQPGETRPLQALLEGRGACSSVASKKLSTILLPTQK
QENAGREKVVTGEEWRTNATVMTTMAVGVVVVEGGGGEHRVALEAKPPLHTKLDVIKKEQ
NKKSQSYKMESGSGGVKTNIPRFSLEDKRETEYDPCRREMESILNSPKISSVLIPRGVRI
PNCDKKGFYKKKQCRPSKGRKRGYCWCVDKYGQPLSSYDGKERGESQCNNLENK
NT seq 885 nt   +upstreamnt  +downstreamnt
atgcccggtctatgcttgttttgtctcactgctgtgctcgctgcattcacccggttcgcg
gaaaccgtgggaacggtggtccgatgcgagccgtgtgacaccgtggctctcatgcagtgc
aagcctctggcaaaagactgcgccgacagcgtacgggagcctggctgtgggtgctgtctg
acgtgcgcccttgcggagggtcaggcgtgtggagtgtacaccgggcgctgtggctccggg
ctgacttgtcagcaccaacccggggagacccgaccactacaagccctgctagagggacgg
ggagcgtgctccagcgtcgcgtccaaaaaactcagcaccattctgctccccacacagaaa
caagagaacgcaggcagggagaaggtggtgacgggggaagagtggcgtaccaatgccacc
gtgatgacgaccatggcggtgggtgtggttgttgttgaaggcggaggcggcgaacaccga
gtggcgttagaggccaaaccgccgctgcacaccaagctggatgtgatcaagaaggagcag
aataagaaaagccagagctacaagatggagtcaggatctgggggagtcaaaaccaacatt
cccaggttttctctggaggacaagagggagaccgagtatgacccatgcaggagagagatg
gagagcattctgaacagtcctaaaatctccagtgtgctcatccccagaggtgtccgcatc
cccaactgtgacaaaaaaggcttctacaagaaaaaacaatgccgtccatccaaagggagg
aagcgaggttactgctggtgtgtggataagtacggtcagcctctctccagctacgatgga
aaggagagaggagaatcccagtgcaacaacctggagaacaaatga

KEGG   Salmo salar (Atlantic salmon): 101448066
Entry
101448066         CDS       T04363                                 

Gene name
igfbp-3b1
Definition
(RefSeq) insulin-like growth factor binding protein 3 paralog B1
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101448066 (igfbp-3b1)
   04218 Cellular senescence
    101448066 (igfbp-3b1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    101448066 (igfbp-3b1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    101448066 (igfbp-3b1)
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    101448066 (igfbp-3b1)
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101448066 (igfbp-3b1)
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 101448066
NCBI-ProteinID: NP_001266096
UniProt: M4Q568
LinkDB
Position
ssa14
AA seq 293 aa
METCYRTLWMTVVLALITRRSAAVGPVIRCEPCDAGARLLCKPLPKDCTERVRETGCGCC
MTCALAFGQPCGVYTGRCGSGMTCQLQPGETKPLQALLEGRGQCAIATIKRSTAALPAVN
EIQENVDGTQEEEQNTTAPVIQAPQALFSTSRPPVGPPRLPHHPSLLHPVKAVVIHREQL
KRARSYKMEELPGAHSTDQQNFSLESKREPEYGPCLKEMESVLKGLKITDILNPRGFHIP
NCDNKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPSFNGKERGDTQCYNSESQ
NT seq 882 nt   +upstreamnt  +downstreamnt
atggagacctgttatcgtacactttggatgacagttgttctggcattgattacgcggaga
tcagccgcggtagggccggttatccggtgtgaaccttgtgatgctggagcccggctcctg
tgcaagccgttgcccaaggactgcaccgagagagttcgcgaaactggctgcgggtgctgc
atgacttgcgcgctggcatttggacagccgtgcggggtgtacacggggagatgtggctcc
gggatgacatgccagctgcagcccggcgagacgaaacctctccaagctctgctggaggga
cgaggacagtgtgcgattgcgaccattaaaagatccaccgctgctttacctgccgtcaat
gagatacaagagaatgtggatggtactcaggaggaggagcaaaacaccaccgccccagtg
atccaagccccccaagcccttttcagcaccagcagacctcctgtaggcccccccagactc
ccccaccacccatctctcctccaccctgtcaaggcagtggtcatccacagggagcagctg
aagagggcccggagctataaaatggaggaactccctggagctcacagcacagaccaacaa
aacttctccctggaatccaagcgggaaccagagtatggtccctgtcttaaagagatggag
agtgtccttaaaggactgaagatcacagacatcctcaaccccagaggcttccacatccca
aactgtgacaataagggcttctacaaaaaaaaacagtgccgtccatccaagggcagaaag
cgagggttttgctggtgtgttgacaagtatgggcagccattgccaagtttcaacgggaag
gagagaggagacacccaatgctacaactctgagagccaataa

KEGG   Salmo salar (Atlantic salmon): 101448067
Entry
101448067         CDS       T04363                                 

Gene name
igfbp-3b2
Definition
(RefSeq) insulin-like growth factor binding protein 3 paralog B2
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    101448067 (igfbp-3b2)
   04218 Cellular senescence
    101448067 (igfbp-3b2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    101448067 (igfbp-3b2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    101448067 (igfbp-3b2)
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    101448067 (igfbp-3b2)
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101448067 (igfbp-3b2)
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 101448067
NCBI-ProteinID: NP_001266099
UniProt: M4QG92
LinkDB
Position
ssa03
AA seq 288 aa
METCFRRLWLTVVLASILRRSVAVGPVIRCEPCDAGARLLCKPLPKDCAERVREPGCGCC
MTCALAFGKPCGVYTGRCGSGMTCQHQPGEKKPLQALLEGRGQCANATIKRTVATIINER
QENDGGIQEEERNTTAPVLQASFSTSRPPVGPPRIPHHPPLLHPVKAEVIRREQLKRAQS
YKMEEVPGALSTDQQNFSLEAKQDPEYGPCRREMESILNGLKITDILNPRGFRIPNCDKK
GFYKKKQCRPSKGRKRSFCWCVDKYGQPLPGFDGKERGDAQCYNSESQ
NT seq 867 nt   +upstreamnt  +downstreamnt
atggagacgtgttttcgcagactttggctgacagttgttctggcatcgattttgcggaga
tcagtcgcggtagggccggttatccggtgcgaaccatgtgatgctggagcccggctcctg
tgcaagccgttgcccaaggactgcgcggagagagttcgcgaaccgggctgcgggtgctgc
atgacttgcgcgctggcctttggaaagccgtgcggagtgtacaccgggagatgtggctcc
gggatgacatgccagcaccagcccggcgagaagaaacctctccaagctctgctagaagga
cgaggacagtgtgcaaacgcgaccattaaaagaactgttgccactataatcaatgagaga
caagaaaatgatggtggtattcaggaggaggagcgaaacaccaccgccccagtgctccaa
gcctccttcagcaccagcagacctcctgtaggcccccccagaatcccccatcacccccct
ctcctccaccctgtcaaggcagaggtcatccgcagggagcagctgaagagggcccagagt
tacaagatggaggaagtacctggagcactcagcacagaccaacagaacttctccctggaa
gccaagcaggacccagagtatggtccctgtcgaagagagatggagagtatcctcaatgga
ctgaagatcacagacatcctcaaccccagaggcttccgcatcccaaactgtgacaagaag
ggcttctacaagaaaaaacagtgccgtccatccaagggcagaaagcgaagcttttgctgg
tgtgtcgataagtatgggcagccattgccaggttttgatgggaaggagagaggagatgct
cagtgctacaactcagagagccaataa

DBGET integrated database retrieval system