KEGG   Salmo salar (Atlantic salmon): 106560269
Entry
106560269         CDS       T04363                                 

Definition
(RefSeq) platelet-derived growth factor receptor alpha-like
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04020  Calcium signaling pathway
sasa04144  Endocytosis
sasa04510  Focal adhesion
sasa04540  Gap junction
sasa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106560269
   04020 Calcium signaling pathway
    106560269
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106560269
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106560269
   04540 Gap junction
    106560269
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106560269
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106560269
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:sasa04090]
    106560269
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     106560269
Protein kinases [BR:sasa01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   106560269
CD molecules [BR:sasa04090]
 Proteins
  106560269
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Receptor_2B4 C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 106560269
NCBI-ProteinID: XP_013978458
UniProt: A0A1S3KIA1
LinkDB
Position
ssa10
AA seq 1467 aa
MDEMKTCLIIGVFLFGLLSVTRGLATPTIVSTEDEFVLEPLSVFNISCTGKRNVAWVEPL
PDDTFILPGYYTSTLFIYNASVTHTGYYSCKYQDKEGDEEVDGVANDAFIYVFVPDPEIP
FVPEESDRMLVPVYPNRTIIPCRVSDPQSQVVLKSAPSGVEVDAVYKNKIGFIGNLEAGL
YICETTVNGMTMTSDTYTVEANKQMENVHVEVKASEEAVRMGEPFNITCVAPPGLPYQQQ
WLHPRKQAVDAVQMKQTLPDRVVYTLSIPAATSQDSGVYECSITNNFSGEIRANRVAVTV
FEENTFVMLDHSGIGVVEFVSMMEETEFTISIEAFPAPKVTWLKDGIAITENSYFLTKTS
RLEGNQHQSTLTLRQPLEEDSGNYTIMVLSNPHTAQFSFTLKVKASAPVLFQPASAPVLF
PQREEMVVPLHTPFTLTCRGEAELAWETPVYLSEQTEEDNSGLFVTTVTVENATVANTGF
YTCFYNGGNSTEEGEDSSIYIYVPDPEVPFVPSLVPFGNHVLNGHDEMEIQCRVSDPSAN
VTLVNTDTQQAVPMTVYDSKRGAVGFFSAGTYVCKALINGEEHLSEEYIVHGWAGGLELR
VELKAQKTALLVGDTITVTCVARGSEILEDHWKYPGKLVNRGLKSVHENKRDQEIQYIMT
VPQASAKDSGIYACSITDIISNESQTKELAITVYESPFVSLRPVFSSQESADLDESREFR
ANIDSFPSAQVTWLKDGLPLNYVAAEITTSLQQLSETRYQSVLTLIRAKEEDSGNYTIRV
QNGNQTHSHSFSLQVKVPAVIVDLMDLHHGSASGQSVVCIAGGMPTPEVEWFICKNIKHC
ANDSSQWVPLPTNDTDITVEAHIDQDNQLESQVIFVRLENTLAVRCLARNAMAAVSREVK
LVSQGPHSELPVTAAVLVLLVIVIISLIVLVIIWKQKPRYEIRWRVIESVSPDGHEYIYV
DPMQLPYDSRWEFSRDGLVLGRVLGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARS
SEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPTYIITEYCFYGDLVNYLHKNRESFLS
LHSEKTKKDLDIFGINPADESSRSYVILSFESGKGDYMEMKQADTTQYVPMLEMSDASKY
SDIQRSEYDHPPSQKGDNEMDSLLSEDGNEGLSTTDLLSFTYQVARGMEFLSSKNCVHRD
LAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNMYTTISDV
WSYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMAKPEHAPADVYEMMIKCWNSEPE
KRPSFLRLSESVASLLPSGYKRCFERASHEFLKSDHPAVTRVQVESDDAYIGITYKSQDK
LKDRESGFDEQRLSSDSGYIIPLPDLDPLSDDEYIKRNRHSSQTSEESAIETGSSFTLAK
REGETLEDISLLDEMCLDSELVEDSFL
NT seq 4404 nt   +upstreamnt  +downstreamnt
atggatgaaatgaagacatgtctcatcattggggttttcttgtttgggttgttatcagtt
acccgcgggctggccacaccgaccattgtatcaactgaagatgagtttgttctcgagccg
ctctccgtgttcaacatcagctgcaccggtaaaaggaacgttgcttgggtcgagccccta
ccagacgacacattcattttgcctggatattacacctccacgctcttcatctacaacgct
tctgtgacacacaccggatattactcctgcaaataccaagacaaagagggcgatgaagag
gtggatggcgtagccaatgatgcgttcatatacgttttcgtcccagatcccgagattcca
tttgtgcctgaggagtcagaccgcatgctagtcccagtctatcccaatagaaccatcatc
ccatgcagggtgtcagaccctcaatcccaggtggtcctaaagagcgctcccagtggagta
gaggtggacgcagtttataagaacaagatcggcttcattggcaacctggaggctggattg
tacatctgtgagaccaccgtgaacggcatgacaatgacgagtgacacttacaccgtggag
gccaacaaacagatggagaacgtccatgtggaggtgaaggccagcgaagaggcagtaaga
atgggggaacccttcaacatcacctgtgtggcacctccaggactgccctaccagcagcag
tggctccaccccaggaaacaggctgtggatgcagtccagatgaaacagactctgcctgat
agagtggtctacaccctcagtatcccagcagccacctctcaggacagtggggtgtatgag
tgttccatcaccaacaacttcagtggagagatcagagccaacagggtggctgtcactgtc
ttcgaagagaacacctttgtgatgttggaccacagtgggattggagtggtggagtttgtc
agtatgatggaggagacagagttcaccatcagtattgaagccttccctgctcctaaagtc
acctggctgaaagacggtatcgccatcactgagaacagctacttcctcaccaagaccagc
cgtctggaggggaaccagcatcagagcaccctgactcttcggcaaccactagaggaggac
agtggtaactacaccatcatggtcctcagcaaccctcacactgcccagttctccttcacc
ctcaaagtgaaagcctcagccccagtgctgttccagccagcctcagccccagtgctgttc
ccccagagagaggagatggttgttcccctccacacccccttcactctgacctgcaggggc
gaggccgagctggcctgggaaacacccgtctacctatcagagcagacagaggaggacaac
agcggcctgtttgtcaccacggttaccgtagagaacgccactgtggcaaacactggtttc
tacacctgcttctacaacggagggaactccactgaggagggagaggacagcagcatctac
atatatgtgccagatccagaggtgccctttgtcccctctctggtgccctttggcaaccac
gtcctgaatggtcatgatgagatggagatccagtgtcgcgtgtcggaccccagtgccaat
gtgaccctggtcaacactgatacccagcaggccgtgcccatgactgtctacgacagcaag
aggggcgccgtgggcttcttcagtgcaggaacctatgtctgcaaggccctcatcaatgga
gaggagcacctcagtgaggagtacatcgtccatggctgggcaggggggttagagctgcgt
gtggagctgaaggcccagaagactgctctcttggtgggagacaccatcactgtcacctgt
gtggcccgggggtctgagatactggaagaccactggaagtaccctggaaaactggtgaac
cgtggtttgaagtcggtgcacgagaataagagggaccaggagatccagtacatcatgact
gtcccccaggcctcagccaaagacagtggcatctacgcctgctccattactgacatcatc
agcaatgagagccagaccaaggagctggccatcactgtctatgagagcccatttgtgtcg
ctgcgccctgtgttcagttctcaggagtcagcagacctggatgagagcagagagttccgg
gccaacatcgactccttccccagcgcccaggtcacatggctcaaagatggcctccccctc
aactatgtggcggctgagataaccaccagcctccagcagctcagcgagaccaggtaccag
agtgttctgaccctgatccgggccaaggaggaggacagtgggaactacaccatcagagtg
cagaacgggaaccagacccacagccacagcttcagcctgcaggtcaaagtacctgcagtc
attgtggacctgatggacctccatcatggctcagcctcaggccagtctgtagtgtgtatc
gctggaggcatgcccactcctgaggtggagtggttcatctgcaagaacataaaacactgt
gccaacgactcgtctcagtgggtgcccctgccaaccaacgacacagatatcactgtggaa
gcgcacatcgaccaggacaaccagctggagagccaggtgatcttcgtgcgtcttgagaac
actctggccgtccgctgcctggccaggaacgcgatggccgccgtcagcagggaggtgaag
ctggtgtcacaaggcccccactctgagctgcctgtaactgctgctgttttggtgctgctg
gtcattgtcatcatctcactcattgtcctggtcattatctggaaacagaagcctcgctat
gagatccgctggagggtgatagagtcagtgagtcctgatggccatgagtacatctacgtg
gaccccatgcagctgccctatgactccagatgggagttctctcgcgatgggctcgtactg
ggtcgtgtcctgggctctggggcgtttgggaaggtggtggagggaactgcatatggactc
agccgctcccagcccgtcatgaaggtggctgtgaagatgctgaaacccacggcccgctcc
agtgagaaacaggccctgatgtcagagctgaagatcatgactcacctgggccctcacctc
aacatcgtcaacctgctgggggcctgcaccaagtcaggccccacctacatcatcactgag
tactgcttctatggagacctggtcaactacctgcacaaaaacagagagagcttcctcagc
ttgcactcagagaagaccaagaaagacctggacatctttggcataaaccctgcagacgag
agcagcaggagctatgtgatcctgtcctttgaaagtggtaaaggagactacatggagatg
aagcaggcagacaccacgcagtacgtgcccatgctggagatgagtgatgcctccaagtac
tctgacatccagaggtctgaatatgaccacccaccatcacagaagggtgataatgagatg
gacagcctgctgtcagaagacggcaacgagggcctcagcaccacagaccttctcagcttt
acctaccaagtggccagaggcatggagttcctgtcctctaagaattgtgtgcatcgggac
ctggctgccaggaacgtcctgctctctcaggggaagatagtgaagatctgtgactttggc
ctggccagagacatcatgcatgacaacaactatgtctccaaaggcagtaccttcctgcca
gtgaagtggatggctcctgagagtatctttgacaacatgtacaccaccatcagtgatgtc
tggtcctacggcatcctcctctgggagattttctctctaggtggcaccccatacccaggg
atggtagtggactccagcttctacaacaagatcaagagtggctacaggatggccaaacct
gagcatgcccccgctgatgtgtatgagatgatgataaagtgttggaacagtgagcctgag
aagaggccttccttcctccgcctgagtgagagtgtggcttcactgctgccctccggttac
aagaggtgcttcgagagggcaagccatgagttcctgaagagtgaccatccagcagtgacc
agggtccaggtggagagtgatgacgcctacattgggatcacctataagagtcaggacaag
ttgaaggacagggagagtggcttcgacgagcagcgcctcagctctgacagcggttacatt
atccccctccctgacctggaccctctgtctgatgatgagtacatcaagaggaaccgccac
agctctcagacatctgaagagagtgccatagagacaggttccagcttcacgctggccaag
agagaaggagagaccctggaggacatcagcctgttggatgagatgtgtctcgactcagag
ctggtggaagacagcttcctgtga

DBGET integrated database retrieval system