KEGG   Salmo salar (Atlantic salmon): 106560362
Entry
106560362         CDS       T04363                                 

Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa04310  Wnt signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04622  RIG-I-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106560362
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106560362
   04012 ErbB signaling pathway
    106560362
   04310 Wnt signaling pathway
    106560362
   04068 FoxO signaling pathway
    106560362
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106560362
   04137 Mitophagy - animal
    106560362
  09143 Cell growth and death
   04210 Apoptosis
    106560362
   04217 Necroptosis
    106560362
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106560362
   04530 Tight junction
    106560362
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106560362
   04621 NOD-like receptor signaling pathway
    106560362
   04622 RIG-I-like receptor signaling pathway
    106560362
   04625 C-type lectin receptor signaling pathway
    106560362
  09152 Endocrine system
   04910 Insulin signaling pathway
    106560362
   04920 Adipocytokine signaling pathway
    106560362
   04912 GnRH signaling pathway
    106560362
   04914 Progesterone-mediated oocyte maturation
    106560362
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106560362
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106560362
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106560362
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 106560362
NCBI-ProteinID: XP_013978684
UniProt: A0A1S3KK28
LinkDB
Position
ssa01
AA seq 249 aa
AGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEDF
QDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKS
DCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRH
KILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDCLFP
ADSEHNKLK
NT seq 749 nt   +upstreamnt  +downstreamnt
tgccgggtacgatgcagtcctcgacagaaacgtggccatcaagaagctcagcagaccctt
tcagaaccagacccatgccaagagggcatacagggaactggtgctcatgaaatgtgtcaa
tcacaaaaatatcatcagtttattaaatgttttcacaccacagaaatcactagaagactt
tcaggatgtgtacctggtgatggagctgatggatgccaacctatgccaggtgattcagat
ggagctagaccatgagagaatgtcctacctgctctaccagatgctgtgtggcatcaaaca
cctgcactcagctggaattatacacagggacctgaaacctagcaatatagtggtgaagtc
tgattgtacgctgaagatcctggactttggcctggccaggactgcaggcaccagcttcat
gatgaccccgtacgtggtgacacggtactacagagctccagaggtcattctgggcatggg
gtacaaagagaacgtggatatatggtcggtggggtgcattatgggagaaatggtgcgtca
caaaatcctgttccctggccgtgactatatcgaccaatggaataaggtgattgagcagct
gggcacgccctcaccagagtttatgaagaagctgcagcccactgtccgtaactatgtaga
gaacagacccaaatacgcaggcctcacctttcccaagctcttccccgactgcctcttccc
tgcagactcagagcacaacaaactcaaag

KEGG   Salmo salar (Atlantic salmon): 106563760
Entry
106563760         CDS       T04363                                 

Definition
(RefSeq) mitogen-activated protein kinase 9-like
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa04310  Wnt signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04622  RIG-I-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106563760
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106563760
   04012 ErbB signaling pathway
    106563760
   04310 Wnt signaling pathway
    106563760
   04068 FoxO signaling pathway
    106563760
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106563760
   04137 Mitophagy - animal
    106563760
  09143 Cell growth and death
   04210 Apoptosis
    106563760
   04217 Necroptosis
    106563760
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106563760
   04530 Tight junction
    106563760
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106563760
   04621 NOD-like receptor signaling pathway
    106563760
   04622 RIG-I-like receptor signaling pathway
    106563760
   04625 C-type lectin receptor signaling pathway
    106563760
  09152 Endocrine system
   04910 Insulin signaling pathway
    106563760
   04920 Adipocytokine signaling pathway
    106563760
   04912 GnRH signaling pathway
    106563760
   04914 Progesterone-mediated oocyte maturation
    106563760
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106563760
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106563760
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106563760
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 106563760
NCBI-ProteinID: XP_013985080
UniProt: A0A1S3L2P4
LinkDB
Position
ssa11
AA seq 421 aa
MSEGEGLFHSVQVGDSTFTVLTRYQQLRAIGSGAQGIVCSALDSVLGVPVAVKKLSRPFQ
NQTHAKRAYRELVLLKCVNHKNIIRLLNVFTPQNSLEEFQDLYLVMELMDASLCQVIHMD
LDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMM
TPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGSVIFQGTDHIDQWNKVIEVLG
TPPMEFMNRLMETVRNYVMNKPQYPGVSFSQLFPDWAFPAETEQDQLKTSQARDLLSKML
VIDPESRISVEDALDHPYIHMWYDPGEADAPPPQISDKQLEEREHSIEQWKELIYDELMD
WEERNQNGVMKENCADEVANHSATASQSSSTSDFSSMSTEQTLASDTDSSCVDTLTGALE
E
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgagtgagggggaggggctcttccacagcgtgcaggtgggtgactccaccttcactgtg
ctgacccgctatcagcagctccgcgccatcgggtctggtgcccagggcattgtctgctcg
gccctggacagtgtccttggggtccctgtggcggtgaagaaactgagccggcccttccag
aaccagacccacgccaagcgggcctatagggagttggtgctgctcaagtgcgtcaatcac
aaaaatattattaggctcctgaatgtcttcacaccacagaattcactggaggagttccag
gatctttacctggtgatggagctgatggatgccagtctgtgccaggtcatccacatggat
ctggaccatgagaggatgtcctacctgctctaccagatcctctgtggcatcagacacctg
cactccgctggcatcatccacagggacctgaagcccagtaacatagtggtgaagtctgac
tgtactctgaagatcctggactttgggctggccagaacagcctgcactaacttcatgatg
accccttacgttgtgacccgatactacagagcaccagaggtcatcctgggcatgaagtat
aaagagaatgtggacatctggtcagtgggatgcatcatgggagagatggtgaagggcagc
gttatattccagggcacggatcacattgaccagtggaacaaggtgattgaggttctgggc
acgccccccatggagtttatgaaccgtttgatggagactgtgaggaactatgtgatgaac
aagccccagtacccaggggtcagcttctctcaactcttccctgactgggccttcccagca
gaaacagagcaggatcaactcaagaccagtcaagcacgggacctcctttccaagatgctg
gtgattgacccagagagccgtatttcagtggaggatgccctggatcacccctacatccac
atgtggtacgacccaggagaggctgatgcgccaccaccacagatatctgataaacaactg
gaggagcgagaacacagcattgaacagtggaaagagctgatctatgacgagttgatggac
tgggaggagaggaaccagaatggagtaatgaaggagaactgtgcagatgaagtggcgaac
cacagtgctacagcatcccagtcgtcctctacgagtgacttctcctcaatgtccactgag
cagaccttggcctctgacaccgacagcagctgtgttgacaccctcacgggggcgctagag
gagtga

KEGG   Salmo salar (Atlantic salmon): 106568502
Entry
106568502         CDS       T04363                                 

Gene name
mapk10
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa04310  Wnt signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04622  RIG-I-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106568502 (mapk10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106568502 (mapk10)
   04012 ErbB signaling pathway
    106568502 (mapk10)
   04310 Wnt signaling pathway
    106568502 (mapk10)
   04068 FoxO signaling pathway
    106568502 (mapk10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106568502 (mapk10)
   04137 Mitophagy - animal
    106568502 (mapk10)
  09143 Cell growth and death
   04210 Apoptosis
    106568502 (mapk10)
   04217 Necroptosis
    106568502 (mapk10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106568502 (mapk10)
   04530 Tight junction
    106568502 (mapk10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106568502 (mapk10)
   04621 NOD-like receptor signaling pathway
    106568502 (mapk10)
   04622 RIG-I-like receptor signaling pathway
    106568502 (mapk10)
   04625 C-type lectin receptor signaling pathway
    106568502 (mapk10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    106568502 (mapk10)
   04920 Adipocytokine signaling pathway
    106568502 (mapk10)
   04912 GnRH signaling pathway
    106568502 (mapk10)
   04914 Progesterone-mediated oocyte maturation
    106568502 (mapk10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106568502 (mapk10)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106568502 (mapk10)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106568502 (mapk10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH RIO1 FTA2
Other DBs
NCBI-GeneID: 106568502
NCBI-ProteinID: XP_013994381
UniProt: A0A1S3LU38
LinkDB
Position
ssa13
AA seq 476 aa
MVFMRRDFFYYCSEPVLDVKIAFCQGFGKQVDVSYICKHYNMSKSKVDNQFYSVEVGDST
FTVLKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKC
VNHKNIISLLNVFTPQKSLEDFQDVYLCMELMDANLCQVIQMELDHERMSYLLYQMLCGI
KHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILG
MGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPAPEFMKKLQPTVRNY
VENRPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLCKMLIIDPAKRIQVDEALQHP
YINVWYDPAEVEAARDLVQISMPPPAIYDKQLDEREHSIDEWKELIYKEVMNFEERTKNG
VVKGQPSTSGAAVNSSGESLPSPSVNDISSMSTDQTLASDTDSSLETSAGPLGCCR
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggtatttatgaggagggatttcttctattactgcagtgaacctgtcctggatgtgaaa
atagccttttgtcagggttttggtaaacaagtggatgtgtcatatatctgcaaacactac
aacatgtctaaaagcaaagtggataaccagttctacagcgtggaagtaggagattccacc
ttcacagttctcaaacgctaccagaatctaaaacccatcggttctggagctcagggaatc
gtctgtgccgggtacgatgcggtcctcgacaggaacgtggccatcaagaagctcagcaga
ccctttcagaaccagacccatgccaagagggcatacagggaactggtgctcatgaaatgt
gtcaatcacaaaaacatcatcagtttattaaatgttttcacaccacagaaatcattagaa
gacttccaggatgtgtacctgtgtatggagctgatggatgccaacctgtgccaggtgatc
cagatggagctggaccatgagagaatgtcttacctgctctaccagatgctgtgtggcatc
aaacacctgcactccgctggcatcattcacagggacctgaaacctagcaatatagtggtg
aaatctgattgtacgctgaagatcctggactttggcttggctaggactgcaggcaccagc
ttcatgatgaccccgtacgtggtgacgaggtactacagagccccagaggtcatcctgggc
atggggtacaaagagaacgtggatatatggtcggtggggtgcattatgggagaaatggtg
cgtcacaaaattctgttccctggccgggactatattgaccaatggaataaggtgattgag
cagctgggcacacctgcaccagagtttatgaagaagctgcagccaaccgtccgtaactat
gtagagaacaggcccaaatacgcaggcctcaccttccccaagctcttccccgactgcctc
ttccccgcagactcagagcacaacaaactcaaagccagccaggccagagacctgttgtgt
aagatgttgattattgatccagccaagcggatacaagtggatgaagccttacagcacccc
tacatcaacgtttggtacgacccagccgaggtggaggcggccagggatctcgtccaaata
tcaatgccgcctcctgctatctacgacaagcagctggatgagagagaacactccatcgat
gaatggaaagaactaatctacaaagaggtgatgaactttgaggagaggacgaagaacggg
gtggtgaagggacagccctctacctcaggtgcagccgtgaacagcagtggtgagagcctc
ccttccccctccgtcaacgatatctcctccatgtccaccgaccagaccctggcctcagac
accgacagcagcctggagacctctgcaggacccctgggttgttgcaggtga

KEGG   Salmo salar (Atlantic salmon): 106576863
Entry
106576863         CDS       T04363                                 

Definition
(RefSeq) mitogen-activated protein kinase 8-like
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa04310  Wnt signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04622  RIG-I-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106576863
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106576863
   04012 ErbB signaling pathway
    106576863
   04310 Wnt signaling pathway
    106576863
   04068 FoxO signaling pathway
    106576863
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106576863
   04137 Mitophagy - animal
    106576863
  09143 Cell growth and death
   04210 Apoptosis
    106576863
   04217 Necroptosis
    106576863
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106576863
   04530 Tight junction
    106576863
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106576863
   04621 NOD-like receptor signaling pathway
    106576863
   04622 RIG-I-like receptor signaling pathway
    106576863
   04625 C-type lectin receptor signaling pathway
    106576863
  09152 Endocrine system
   04910 Insulin signaling pathway
    106576863
   04920 Adipocytokine signaling pathway
    106576863
   04912 GnRH signaling pathway
    106576863
   04914 Progesterone-mediated oocyte maturation
    106576863
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106576863
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106576863
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106576863
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 106576863
NCBI-ProteinID: XP_014009834
UniProt: A0A1S3N3D3
LinkDB
Position
ssa18
AA seq 436 aa
MNKNKRGGEREFYSLDVGDSTFKVLKRYQNLRPIGSGAQGIVCSAYDHNLERNVAIKKLS
RPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFSPQKSLEEFADVYIVMELMDANLCQV
IQMELDHERLSYLLYQMLCGIKHLHNAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAAT
GLLMTPYVVTRYYRAPEVILGMGYQANVDIWSVGCILAEMVRHKILFPGRDYIDQWNKVI
EQLGTPPQEFLMKLNQSVRTYVENRPRYAGYSFDKLFPDVLFPADSEHNKLKASQARDLL
SKMLVIDSSKRISVDEALKHPYINVWYDPAEVEAPPPKITDKQLDEREHTVEEWKDLIWK
EVYEWDEWTKQNGVIRGQPPPLGAAVIDSSPQPASSSSSANDVSSMSTEPSDPTMTSDTD
ISLDSHTSLGALACCR
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgaataaaaacaagcgaggaggagagagggagttctatagtttagatgtcggagattcc
accttcaaagttctgaagcgctaccagaatctaaggcccatcggctcaggagcacaggga
atcgtctgttcagcgtatgaccacaatcttgagagaaatgtggctattaagaagttgagt
cggccgttccagaaccagacgcatgccaagagagcatacagagaactggtgttaatgaaa
tgtgtcaatcacaaaaatatcattggcttattaaacgtattcagcccacaaaaatcatta
gaagaatttgcagatgtatacattgtgatggagctgatggatgccaacctgtgccaggtg
attcagatggagctggaccatgagaggttgtcctacctgctctaccagatgctgtgtggc
atcaaacacctccacaatgccggcatcatacacagggatctgaagcccagtaacattgtg
gtgaagtcagactgtacattaaagatcttggactttggcttggctcggacagcggctaca
ggtttactgatgaccccctacgtagtgaccagatactacagagcaccagaggtcatactg
gggatgggctaccaggccaacgtggacatatggtctgtggggtgtattctggcagaaatg
gtccgtcacaaaatcctgttcccaggaagggactacattgaccagtggaacaaagtgata
gagcagctcgggactccgccccaggagtttctgatgaagctcaaccaatcagtaaggacg
tatgttgagaaccgaccgcgctacgcaggatacagcttcgacaaactcttccctgacgtc
ctcttccctgcagactcagaacacaacaaattgaaagcgagccaggccagagatctgctg
tctaagatgttggtgatcgactcgtctaagaggatctcggtggacgaggccctgaaacac
ccctatatcaacgtgtggtatgacccagcagaagtggaggcaccccctccaaagatcaca
gacaagcagctggatgagcgagagcatacagtggaggagtggaaagacctgatctggaag
gaggtgtatgagtgggacgaatggaccaagcagaatggagtgatcagaggacaacctcct
cctttaggtgcagcagtgattgacagctcccctcagcccgcctcatcctcctcctcggcc
aatgacgtatcctccatgtcgactgagccaagtgaccccaccatgacctctgacacggac
atcagcctggacagccacacctccctgggagcactggcctgctgcagataa

KEGG   Salmo salar (Atlantic salmon): 106579004
Entry
106579004         CDS       T04363                                 

Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa04310  Wnt signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04622  RIG-I-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106579004
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106579004
   04012 ErbB signaling pathway
    106579004
   04310 Wnt signaling pathway
    106579004
   04068 FoxO signaling pathway
    106579004
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106579004
   04137 Mitophagy - animal
    106579004
  09143 Cell growth and death
   04210 Apoptosis
    106579004
   04217 Necroptosis
    106579004
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106579004
   04530 Tight junction
    106579004
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106579004
   04621 NOD-like receptor signaling pathway
    106579004
   04622 RIG-I-like receptor signaling pathway
    106579004
   04625 C-type lectin receptor signaling pathway
    106579004
  09152 Endocrine system
   04910 Insulin signaling pathway
    106579004
   04920 Adipocytokine signaling pathway
    106579004
   04912 GnRH signaling pathway
    106579004
   04914 Progesterone-mediated oocyte maturation
    106579004
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106579004
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106579004
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106579004
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like FTA2
Other DBs
NCBI-GeneID: 106579004
NCBI-ProteinID: XP_014013867
UniProt: A0A1S3NEN3
LinkDB
Position
ssa19
AA seq 431 aa
MNRNKREKEYYSLDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHNLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYIVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSIGCIMAEMVRGSVLFPGTDHIDQWNKVIEQ
LGTPSQEFLMKLNQSVRTYVENRPRYAGYTFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVSEALQHPYINVWYDPTEVEAPPPLITDKQLDEREHTVEEWKDLIYMEV
QDWEERTKNGVIRGQPSSLGAAVSSSFQQHPSASSSSANDVSSMSTDPTLASDTDSSLET
ASNTDPLGCCR
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgaatcggaataagcgtgaaaaggagtattacagtttagacgtcggggattccactttt
acggttttgaagcgctaccagaatttaagacccataggctccggagcacaggggattgtc
tgctcagcatatgaccacaaccttgaacgaaatgtggcaattaaaaaactcagccggcct
ttccagaaccagacccatgccaaaagagcttacagagaactggtgctcatgaaatgtgtc
aaccataagaacattatcggcctattaaatgtattcacgccacagaagacgctggaagaa
tttcaagatgtgtatattgtgatggagctgatggatgccaacctgtgccaggtgattcag
atggagctggaccacgagcggctgtcctatctgctctaccagatgctgtgtggcatcaag
caccttcacgccgcgggcatcatacacagggatctgaaacccagcaacatcgtggtaaag
tctgactgcacgctgaagatcctggactttggattggccaggacagcggccacgggcctc
ctgatgaccccgtacgtggtgacccgctactaccgtgcccctgaagtcatattgggcatg
ggttaccaggccaacgttgatgtctggtctattggctgcatcatggcagaaatggtccga
ggtagtgtgttgttcccaggcacagatcatattgatcagtggaacaaggtgatcgagcag
ctggggactccaagtcaggagttcctgatgaagctcaaccagtcagtgaggacttacgtg
gaaaacagaccccgctatgccggctataccttcgagaagctcttccccgatgtcctcttc
ccagccgactcagagcacaacaaactgaaagcaagtcaagccagagacctattatcgaag
atgctggtaatagatgcatccaaacggatctctgtgagcgaggctctccagcacccctac
ataaacgtgtggtatgatccaactgaagtggaggcgcccccaccgctgatcacagacaag
cagctggatgagagggagcacacggtggaggagtggaaagatttgatatacatggaggtc
caggactgggaggagagaacgaagaatggagtgatccggggacaaccatcgtctttaggt
gcagcagtgagcagcagcttccagcagcacccttctgcgtcgtcctcgtccgccaacgat
gtgtcctccatgtccaccgaccccaccctggcctcggacacagacagcagcctggagacg
gcctctaacacggacccgctgggctgctgcagatga

KEGG   Salmo salar (Atlantic salmon): 106589346
Entry
106589346         CDS       T04363                                 

Definition
(RefSeq) mitogen-activated protein kinase 8-like
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa04310  Wnt signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04622  RIG-I-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106589346
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106589346
   04012 ErbB signaling pathway
    106589346
   04310 Wnt signaling pathway
    106589346
   04068 FoxO signaling pathway
    106589346
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106589346
   04137 Mitophagy - animal
    106589346
  09143 Cell growth and death
   04210 Apoptosis
    106589346
   04217 Necroptosis
    106589346
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106589346
   04530 Tight junction
    106589346
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106589346
   04621 NOD-like receptor signaling pathway
    106589346
   04622 RIG-I-like receptor signaling pathway
    106589346
   04625 C-type lectin receptor signaling pathway
    106589346
  09152 Endocrine system
   04910 Insulin signaling pathway
    106589346
   04920 Adipocytokine signaling pathway
    106589346
   04912 GnRH signaling pathway
    106589346
   04914 Progesterone-mediated oocyte maturation
    106589346
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106589346
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106589346
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106589346
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like FTA2
Other DBs
NCBI-GeneID: 106589346
NCBI-ProteinID: XP_014034665
UniProt: A0A1S3Q3X9
LinkDB
Position
ssa28
AA seq 428 aa
MNRNKREKEFYSLDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHNLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYIVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSIGCIMAEMVRGSVLFPGTDHIDQWNKVIEQ
LGTPSQEFLMKLNQSVRTYVENRPRYAGFTFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVSEALQHPYINVWYDPTEVEAPPPLITDKQLDEREHTVEEWKDLIYMEV
QDWEERTKNGVIRGQPASLGAAVSSSSQQYPSVSSTSVNDVSTNPTLASDTDSSLETASN
TDPLGCCR
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgaatcggaataagcgtgaaaaggagttttacagtttagatgtcggtgattccactttt
acggttttgaagcgctaccagaatttaagacccataggctccggagcacaggggattgtc
tgctcagcatatgaccacaaccttgaacgcaatgttgcaattaaaaaactcagccgacct
ttccagaaccagacccatgccaaaagagcttacagagaactggtgctcatgaaatgtgtc
aaccataagaacattattggcttgttaaatgtattcacgccacagaagacactggaggag
ttccaagatgtttatattgtgatggagctgatggatgccaacctgtgccaggtgatccag
atggagctggatcacgagcggctgtcctatctgctctaccagatgctgtgtggcatcaag
caccttcacgccgcgggcatcatacacagggatctgaaacccagcaacattgtggtaaag
tcggactgcacactgaagatcctggacttcggattggccaggacagcggccacaggcctc
ctgatgaccccgtatgtggtgacccgctactaccgcgcccctgaagtcatcttgggcatg
ggttaccaggccaacgttgatgtctggtctattggctgcatcatggcagaaatggtccga
ggtagtgtgttgttcccaggcacagatcatattgatcagtggaacaaggtgatcgagcag
ttggggactcccagtcaggagttcctgatgaagctcaaccagtcggtaaggacctatgtg
gagaacagaccccgctacgccgggttcacctttgagaagctcttccctgacgtcctcttc
ccagccgactcggagcacaacaaactgaaagcaagtcaagccagagacctattatcaaag
atgctggtaatagatgcatccaaacggatctctgtgagcgaggctctccagcacccctac
atcaacgtgtggtatgatccaactgaagtggaggcgcccccaccgttgatcactgacaag
cagctggatgagagggaacacacagtggaggagtggaaagatttgatatacatggaggtc
caggactgggaggagagaacgaagaatggagtgatccggggacagccagcatctttaggt
gcagcagtgagcagcagctcccagcagtacccttctgtatcgtccacgtccgtcaacgat
gtgtccaccaaccccaccctggcttccgacacggacagcagcctggagacagcctctaac
acggacccactgggctgctgcagatga

KEGG   Salmo salar (Atlantic salmon): 106604288
Entry
106604288         CDS       T04363                                 

Gene name
mapk8
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa04310  Wnt signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04622  RIG-I-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106604288 (mapk8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106604288 (mapk8)
   04012 ErbB signaling pathway
    106604288 (mapk8)
   04310 Wnt signaling pathway
    106604288 (mapk8)
   04068 FoxO signaling pathway
    106604288 (mapk8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106604288 (mapk8)
   04137 Mitophagy - animal
    106604288 (mapk8)
  09143 Cell growth and death
   04210 Apoptosis
    106604288 (mapk8)
   04217 Necroptosis
    106604288 (mapk8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106604288 (mapk8)
   04530 Tight junction
    106604288 (mapk8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106604288 (mapk8)
   04621 NOD-like receptor signaling pathway
    106604288 (mapk8)
   04622 RIG-I-like receptor signaling pathway
    106604288 (mapk8)
   04625 C-type lectin receptor signaling pathway
    106604288 (mapk8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    106604288 (mapk8)
   04920 Adipocytokine signaling pathway
    106604288 (mapk8)
   04912 GnRH signaling pathway
    106604288 (mapk8)
   04914 Progesterone-mediated oocyte maturation
    106604288 (mapk8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106604288 (mapk8)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106604288 (mapk8)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106604288 (mapk8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 106604288
NCBI-ProteinID: XP_014054256
UniProt: A0A1S3RR11
LinkDB
Position
ssa01
AA seq 439 aa
MNNNKRGEEREFYSLDIGDSTFTVLKCYQNLRPIGSGAQGIVCSAYDHNLERNVAIKKLS
RPFQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFSPQKSLEEFADVYIVMELMDANLCQV
IQMELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAAT
GLLMTPYVVTRYYRAPEVILGMGYQANVDIWSVGCILAEMIRHKILFAGRDYIDQWNKVI
EQLGTPPQEFLMKLNQSVRTYVENRPRYAGYSFDKLFPDVLFPADSEHNKLKASQARDLL
SRMLVIDSSKRISVDEALKHPYINVWYDPAEVEAPPPKITDKQLDEREHTVEEWKDLIWK
EVYEWDEWTKHYGVIRGQPPLLGAAVIDSSPQHPSSSYSANDVSSMSTDPSDPSEPTMTS
DTDSSLDSHTSLGALACCR
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgaataacaacaagcgaggagaagagagggagttctacagtttagatatcggagattcc
accttcacagttctgaaatgctaccagaatctaaggcccatcggctcaggagcacaggga
atcgtctgttcagcgtatgaccacaaccttgagagaaatgtggctattaagaagttgagt
cggccgttccagaaccagacgcatgccaagagagcgtacagagaactggtattaatgaaa
tgtgtcaatcacaaaaatatcattggcctattaaacgtattcagcccacaaaaatcatta
gaagaatttgcagatgtatacattgtgatggagctgatggatgccaacttgtgccaggtg
attcagatggagctggatcatgagaggttgtcctacttgctctaccagatgctgtgtggc
atcaaacacctccatgctgccggcatcatacacagggatctaaagcccagtaacattgtg
gtgaagtcagactgtacgttgaagatcttggactttggcttggctcggacggcggctaca
ggtctgctgatgaccccctacgtagtgaccagatactacagagcaccagaggtcatactg
gggatgggctaccaggccaacgtggacatatggtctgtggggtgtattctggcagaaatg
atccgccacaaaatcttgttcgcaggaagggactacattgaccagtggaacaaggtgata
gagcagcttgggactccgccccaggagttcttgatgaagctcaaccaatcagtgaggaca
tacgtagagaacaggccgcgttacgcaggatacagctttgacaaactcttccctgacgtc
ctcttccctgcagactcagagcacaacaaactgaaagcgagccaggccagagacctgctg
tctaggatgttggtgatcgactcgtctaagaggatctctgtggacgaggccctgaaacac
ccctatatcaatgtgtggtacgacccagcagaagtggaggcgccccctccgaagatcaca
gacaagcagctggatgagcgagagcatacggtggaggagtggaaagacctgatctggaag
gaggtgtatgagtgggatgagtggaccaagcattatggtgtgatcagaggacaacctcct
cttttaggtgcagcagtgattgacagctcccctcagcacccctcgtcctcctactcggcc
aatgacgtatcctccatgtcgactgaccccagtgaccctagtgaacccaccatgacctct
gacacggacagcagcctggacagccacacctctctgggagcactggcctgctgcagataa

KEGG   Salmo salar (Atlantic salmon): 106604910
Entry
106604910         CDS       T04363                                 

Definition
(RefSeq) mitogen-activated protein kinase 9-like
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa04310  Wnt signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04622  RIG-I-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106604910
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106604910
   04012 ErbB signaling pathway
    106604910
   04310 Wnt signaling pathway
    106604910
   04068 FoxO signaling pathway
    106604910
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106604910
   04137 Mitophagy - animal
    106604910
  09143 Cell growth and death
   04210 Apoptosis
    106604910
   04217 Necroptosis
    106604910
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106604910
   04530 Tight junction
    106604910
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106604910
   04621 NOD-like receptor signaling pathway
    106604910
   04622 RIG-I-like receptor signaling pathway
    106604910
   04625 C-type lectin receptor signaling pathway
    106604910
  09152 Endocrine system
   04910 Insulin signaling pathway
    106604910
   04920 Adipocytokine signaling pathway
    106604910
   04912 GnRH signaling pathway
    106604910
   04914 Progesterone-mediated oocyte maturation
    106604910
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106604910
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106604910
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106604910
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 106604910
NCBI-ProteinID: XP_014055506
UniProt: A0A1S3RTA6
LinkDB
Position
ssa05
AA seq 419 aa
MSVGEGQFYSVQVGDSTFTVLKRYQELRAIGSGAQGIVCSALDSVLGFPVAVKKLCRPFQ
NQTHAKRAYRELVLLKCVNHKNIIRLINVFTPQKSLEEFQDLYLVMELMDASLCQVIHMD
LDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMM
TPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGNVIFQGTDHIDQWNKVIEVLG
TPSMEFMNRLMETVRNYVMNKPQYPGVNFAELFPDWAFPSDSEHDRLKTGQARDLLSKML
VIDPESRISVEEALNHPYIHVWYDPGEADAPPPQICDKQLEEREHSIEQWKELIYEELID
WEERNKNGVMKEESEAVTGLASQLSSANDISSMSTEQTLASDTDSSSIDTLTGPLDESQ
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgagtgtgggtgagggccagttctacagtgtgcaggtgggagactccaccttcactgtt
ctgaagcgctaccaggagctcagggctatcggctctggggcacagggcattgtctgctct
gctctagactcagtgttaggttttcccgtggcagtaaagaagctgtgtcggccattccag
aaccagactcatgccaagcgggcctacagggaactggtgctactcaaatgtgtcaaccac
aaaaacattatcaggttgatcaatgtgttcacgcctcagaaatcactggaggagtttcag
gacctctacctagtgatggagctaatggatgccagtctgtgccaggtgatccacatggac
ctggaccatgagaggatgtcctacctgctctaccagatcctctgtggcatcagacacctg
cactccgctggtatcatccacagggatctgaagcccagtaacatagttgtcaagtcagac
tgtactctgaagatcctggactttggattggccagaacggcctgcaccaacttcatgatg
accccttatgtggtgactaggtactacagggctccagaagtcatcctgggcatgaagtac
aaggagaatgtggacatctggtcagtggggtgcatcatgggagaaatggtgaagggcaac
gttatcttccagggcaccgaccacatagaccagtggaacaaggtgattgaggtgctgggt
actccctccatggagtttatgaaccggctgatggagacagtgaggaactatgtgatgaac
aagcctcaatacccaggggtcaacttcgctgaactatttcctgactgggccttcccctct
gattccgaacacgacagactcaagacgggtcaagctcgggacctgctgtccaaaatgctg
gtgatcgatcccgagagccgcatctctgtggaagaggccctgaatcacccgtatatccat
gtgtggtacgatccaggagaggcagatgcgcctcccccacagatctgtgacaagcagcta
gaggagagggaacacagcatcgaacagtggaaagagctcatttatgaagaattgatagac
tgggaggagaggaacaagaatggagtgatgaaagaagagtcagaggcagtgacggggttg
gcctcccagttgtcctcagccaatgacatctcgtccatgtcaacagagcaaaccctggcc
tcagacactgacagcagcagcattgacacactcactggacccctggacgagagccaatga

DBGET integrated database retrieval system