KEGG   Salmo salar (Atlantic salmon): 106560399
Entry
106560399         CDS       T04363                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1-like
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00562  Inositol phosphate metabolism
sasa01100  Metabolic pathways
sasa04012  ErbB signaling pathway
sasa04020  Calcium signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04370  VEGF signaling pathway
Module
sasa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106560399
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106560399
   04370 VEGF signaling pathway
    106560399
   04020 Calcium signaling pathway
    106560399
   04070 Phosphatidylinositol signaling system
    106560399
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106560399
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     106560399
Membrane trafficking [BR:sasa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    106560399
 Endocytosis
  Macropinocytosis
   Phospholipase C
    106560399
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 PH SH3_9 PH_12 SH3_2 EF-hand_6 GDPD
Other DBs
NCBI-GeneID: 106560399
NCBI-ProteinID: XP_013978754
UniProt: A0A1S3KK96
LinkDB
Position
ssa10
AA seq 1326 aa
MCAARFSSSSSVNGCGGVGDRDETTTNGPGTGPATTSRMLDWSEEGTRILHSLEIGTVMT
VFYQKKSQRPERRTFQIRQDTRQIAWSRNPDKIEGEIDITEIRELRLGKCSRDFERYPEE
ARKLDSAHCFIVLYGLEFRLKTLSVAAFSEEEVNMWITGLNWLMMDTQRASAPQQIDRWL
RRQFEVMDRNREGSITVKDVKAHLPHINYRVPNMRFLKDKLQEVEARCDLSFPHFAQLYR
TLMFDAQRSITEQLELSFPLRNVDRPELCQISFYDFQKFLQLDQKESWASDLSRVREFLM
GYLRGGAQTEPMLQLDEFLTFLYSKENSLCNPRPAVVVSDDMKRPLSQYWISSSHNTYLT
GDQFSSESSLEAYARCLRMGCRCIELDCWDGPDDLPIIYHGHTLTSKIKFLDVLHTIKEH
AFVTSEYPVILSIEDHCSVVQQRNMATHFKKVFGDLLLTKPVDLNADELPSPYQLRRKIL
IKHKKLVEGTLYEEVTSASYSEGDISNSLRNGILYLEDPIDHTWTPHYFVLSSNKIYYSE
ETSHYQTAEEEEEEEEEEGGRGKEECNNNEQHCAERWFHGKLGGGRDGRQVAEKLLQEYC
EGGGKDGTFLVRESETFVGDYTLSFWRSGRVQHCRIHSRQESGSTRYYLTDNLVFDSLYR
LICHYRDTPLRCNEFEMRLGSPVPQPNAHESREWFHSSLSRVQAEHMLMRVPRDGAYLLR
KRSDINSYAISFRAEGKIKHCRIQQEGRMFMLGSSAEFESLVDLVSYYEKHPLYRKMRLR
YPINEDTLDRMGTTELDYGALYEVRTPHFYVEANKMPTARCTVKALYDYRAQRDDELCFP
KQALILSVDKQEGGWWRGDYGGKKQLWFPANYVEEVPNSPACETGDEASTENSPLGTFLK
GFIDVPTCHVVVQKDGKSSRPYVFTVHSQQMSIHPGQALDIASDTLEDLTGWVGKIREAT
QNADARMQEEKQMERRKKIALELSELVVYCRPVPFNEEKIGTERACFRDMSSFPETKAEK
FATRARGKRFLQYNRRQLSRVYPRGQRLDSSNYDPLPMWLCGSQLVALNFQTPDKPMQLN
QALFMLGGGSGFVLQPDIMRDDAFDPFDKDTLRLEPITIQLQVLGARHLPKNGRSIVCPF
VEVEVCGADYDCSKSKTDVVADNGLNPVWVQRQFVFDVHNPSFSFLRFLVYEEDMFSDPN
FLAQAIYPVRSLRTGYRSVPLKNSYSEELELASLLVHIEIVNAKEEDDQNLYSSIQRLRD
RTSELSNQVSLLERAGSGGDHSYQQSLEELRAAQDQLSELVETRNHRLIEKKRREKLRQQ
VGVKRN
NT seq 3981 nt   +upstreamnt  +downstreamnt
atgtgtgctgccaggttcagtagcagcagtagcgtcaacggctgtgggggcgttggggac
cgggatgagaccactacgaatggacccggtacgggcccggccaccacatcccgcatgctg
gactggtccgaggagggcacccgcatcctccacagcctggagattggaacggtcatgacc
gtgttctaccagaagaagtcccagcgaccggagaggaggaccttccagatacgacaggac
actagacagatagcgtggagccgcaaccctgacaagatagagggagagattgatatcacg
gagatcagggagctgaggttgggtaaatgttcccgggactttgagcgttatccagaggag
gctcgtaaattagactccgcccactgcttcatcgtgctctacggactggagttccgcctc
aaaacactcagcgtggccgccttcagtgaggaggaggtcaatatgtggatcactggactc
aactggctgatgatggatactcagagagcctcagcaccacaacagatagacaggtggctg
aggagacaatttgaggtgatggacaggaatcgtgagggaagtatcacagtaaaggatgtg
aaggcccatttacctcatatcaactacagagtccccaacatgcgcttcctcaaagacaag
ctacaggaagtggaagccaggtgtgatctctccttccctcactttgctcagctctacaga
acattgatgttcgacgcacagaggagtatcactgagcagctggagctctccttccccctc
cggaatgtggacagaccagagctgtgtcagatctctttttacgacttccagaagtttcta
cagctggatcagaaggagtcgtgggcgtcggacctgagccgcgtcagagagttcctaatg
ggctacctgaggggtggagcacagaccgaacctatgctacagctagatgagttcctgacg
ttcctgtactccaaggagaactcattgtgtaaccctcgacctgctgttgttgtctctgac
gacatgaagagacccctgtctcagtactggatctcctcatcacacaacacgtatctgaca
ggtgatcagttctccagtgagtcatctctagaggcctacgctcgttgcctgaggatgggc
tgtcgctgcatagaacttgattgctgggatgggcccgatgacctgccaatcatctaccat
ggccacactctcacctccaagatcaaattcctggacgtgctgcacaccatcaaagagcat
gcctttgtcacgtcagagtacccagtgattctgtccatagaggaccactgtagtgtggtc
caacaaaggaacatggctactcattttaagaaggtgtttggagatctgctgctgaccaaa
ccagtggacctgaatgcagatgagctgccctcgccctaccagctacgcaggaagatactc
atcaagcataagaaactggtggagggcactctgtacgaagaggtgacgtcagccagctac
tctgagggtgacatcagtaactccctcaggaatggcattctctacctggaagacccaata
gaccacacatggactccccactactttgttctgagcagtaataagatctactactcagag
gagacttctcactaccagactgccgaggaagaggaggaggaggaggaagaggaggggggg
agggggaaagaggagtgtaacaacaatgagcagcactgtgcagagcgctggttccatggg
aagctgggaggggggcgggatgggagacaggttgccgagaaactgctgcaggagtactgt
gagggcgggggcaaggatgggaccttcctggtccgagagagtgagaccttcgtaggagac
tacactctctccttctggcgatctgggcgtgtgcagcactgtaggatccactcccgccag
gagtctggctccacccgctactacctgactgacaacttggtgtttgacagcctgtataga
ctcatctgccactacagagacacgcccctacgctgcaacgagtttgagatgaggctgggc
agccctgtaccacagcccaacgcacacgagagcagagagtggttccactccagtctgtct
cgtgtacaggctgaacacatgttgatgagggtacccagagatggggcctacctgctccgc
aaacgcagcgacatcaactcctacgcaatctccttcagggcggagggtaagatcaaacac
tgtcgtatccagcaggagggccgtatgttcatgttgggtagctcagcagagtttgagagt
ctggttgacttggtcagctactatgagaaacaccccctgtaccgcaaaatgaggctgcgc
taccccatcaacgaagacacactggaccgcatgggcaccacggagctagactatggagcg
ttgtatgaagtcaggaccccacatttctacgtcgaggccaacaagatgcccacggctcgg
tgtacggtcaaggccctgtatgactacagagcccagagggacgatgagctgtgtttcccc
aaacaggccctcatcctcagcgtggacaagcaggaaggaggctggtggcgaggtgattac
ggagggaagaagcagctgtggtttcctgccaactacgtagaagaagtccccaactcaccc
gcctgcgagacaggagacgaggcatctacagagaacagtccactaggaacatttctcaag
ggcttcatcgatgtgcccacctgccacgtagtggttcagaaggatgggaagagttccagg
ccatatgtgttcactgtccactcccagcagatgtcaattcaccctggccaggcgctggac
attgcttcagacaccctggaggacctgaccggttgggtggggaagatcagagaggccaca
cagaacgcagacgcacggatgcaggaagagaagcagatggagaggaggaagaaaatcgcg
ctggagctctctgagctggtggtctactgtagacctgtccccttcaacgaagagaagatc
gggacagagcgggcatgtttccgggatatgtcatcattcccagagaccaaggcagagaag
tttgccacgcgggcaagagggaagcgcttcctgcagtataaccgccgccagctctcccgg
gtctacccaagaggacagagactagactcctctaactacgaccctttacccatgtggctc
tgtggatcccagctggttgctctcaacttccagacacctgacaagcccatgcagttgaac
caggctctattcatgctgggtggggggagtggctttgtgctccagcctgacatcatgagg
gatgacgcctttgacccctttgacaaggacaccctccgcctggagccaatcaccatccag
ctacaggtactgggagctcgtcacctacctaagaatggccgcagtatagtgtgtcccttt
gtggaggttgaggtgtgtggggccgactacgactgcagcaagagcaagaccgacgtcgtg
gctgacaatgggttgaacccagtgtgggttcagaggcagtttgtgtttgacgtccataac
ccgtccttctccttcctgcgttttttggtctatgaggaggacatgttctctgaccccaac
ttcctggctcaggccatctaccctgtccgctcactaagaacaggctacaggagtgttcca
ctaaagaacagttacagtgaagagttggagctggcttctctgctggttcacattgagatt
gtcaacgccaaggaggaagatgatcagaacctgtactcgtccatccaaaggctgagagac
cgcaccagtgagctgtccaatcaggtgtcacttctggagagggcggggtcaggaggtgac
cacagctaccagcagagtctggaggagctgagagcagcacaagatcagctcagtgaacta
gtggagacacgcaaccacaggctgattgagaagaagaggagggagaagctgaggcagcag
gtgggggtcaagcgcaactaa

KEGG   Salmo salar (Atlantic salmon): 106566556
Entry
106566556         CDS       T04363                                 

Gene name
plcg1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00562  Inositol phosphate metabolism
sasa01100  Metabolic pathways
sasa04012  ErbB signaling pathway
sasa04020  Calcium signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04370  VEGF signaling pathway
Module
sasa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106566556 (plcg1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106566556 (plcg1)
   04370 VEGF signaling pathway
    106566556 (plcg1)
   04020 Calcium signaling pathway
    106566556 (plcg1)
   04070 Phosphatidylinositol signaling system
    106566556 (plcg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106566556 (plcg1)
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     106566556 (plcg1)
Membrane trafficking [BR:sasa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    106566556 (plcg1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    106566556 (plcg1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 PH C2 SH3_9 SH3_2 PH_12 GDPD Mcp5_PH
Other DBs
NCBI-GeneID: 106566556
NCBI-ProteinID: XP_013990141
UniProt: A0A1S3LGS1
LinkDB
Position
ssa13
AA seq 1317 aa
MAGTSGFFSNGPIPWIESDTEMNNLYRDLELGTVLTLFYSKKSQRPERRTFQVKLETRTI
IWTRGTDKIEGEIDIREIKEIRAGQKSRDFERYVEDSTARLDQAHCFVILHGTEFRLKAL
SLAATSDEEMTMWVKGLTWLVADTLKSPTPLQIERWLRKQFYAVDRNREDKISCKDLKSM
LCQVNYRVPNMKFLREKLPDSELRNGDVSFSQFSQLYRSLMFDAQKAMEIPFLQRFIERP
EQKILLEDFKTFLLEAQKELWATDNNKVQEFMFGYLKDPLREVEQPFFHQDEFLTYLFSK
ENTVWDSALDQVCPEDMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMGCRCIE
LDCWDGPDGMPVIYHGHTLTTKIKFCDVLATIKEHAFVTSDYPIILSIEDHCSIVQQRNM
ATYFKKVFGEMLLTKAVDISADGLPSPNQLKRKILIKHKKLAEGSAYEEVSTSTPYSEND
ISNSIKNGILFLEDPINHEWYPHFFVLTSSKIYYSEETSNNQGNEDEEEHREISNGMDQH
IAEKWFHGKLGAGRDGRQIAERLLSEYCLETGAPDGSFLVRESETFVGDYTLSFWRSGRV
QHCRIHSRQEAGSPKFYLTDNLVFDTLFALITHYQQVALRCNEFEMKLTEPVPQTNAHES
KEWYHANLSRSHAENMLMRVPRDGAFLVRKRAELSSFAISFRAEGKIKHCRVQQEGQTVV
LGTSEFDSLVDLISYYEKHPLYRKMKLRYPINEETLEKIGTAEPDYGSLYEGRNPGFYVE
ANQMPTFKCTVKAMYEYKAQRDDELSFSKNAIIQNVDKQEGGWWKGDCGGKKQLWFPANY
VEEISPSAVEPDRSQLTENSPLGDLLRGSVDVSSCQIVVRPDGKGSRLHVFSLLPAASPR
AGQVLDIAANTQEELKEWVIKIREVTMTSEAKLEEGKMMERRKKIALELSDLVIYCRPVP
FDEDKIGTERACFRDMSSFPETKAEKYVNRIKGKRFLQYNRLQLSRIYPRGQRLDSSNYD
PLPMWLCGSQLVALNFQTADKPMQMNQALFMLNGRSGYVLQPPIMRDDNFDPFDRHTLRG
LESVTLQIEVLGARHLPKHGRGIVCPLIELEVCGAEYDSAKQKTDSEADNGLNPTWPRKP
FQFTVCNSAFAFLRFVVYEIDMFSDQNFLAQASFPINSLKTGYRSVPLKNSCNEDLELAS
LLVHMDITRSRAENGEVLSPFLPVGGVSAAVVTQTGRERLGETGSTSSASSMSPLPQSPA
AQTQAQTQAYRGREGSFEARYQTPLDDFRVSQEALLDLDPQNRRMMRRTRVGGENRV
NT seq 3954 nt   +upstreamnt  +downstreamnt
atggctgggacctcgggcttcttttccaacggacccattccgtggattgagagtgacacc
gagatgaacaatctttaccgggatctggaattggggaccgtgttgactttgttttactcc
aaaaagtcccagcgacctgagagaagaacatttcaggtcaaacttgagacgaggacaatt
atctggacccgaggcacagacaaaatagagggagaaattgatatccgagagataaaggag
atccgagcgggccagaagtctcgggactttgagcgctatgtggaggactctacagcacga
ctagaccaggctcactgcttcgtcatcctacacggcactgagttccgcctcaaagcgctc
agcctagcagcgacatctgatgaggagatgaccatgtgggtgaaggggctgacctggctg
gtggcagacacactcaaatcccccacccctctacagatagagaggtggttacggaagcag
ttttatgccgtcgatcgcaacagagaagacaagatatcctgtaaggatctgaagagcatg
ctgtgccaggttaactacagggtccccaacatgaagttcctcagagagaaacttccggac
tcggagttgaggaatggagacgtgtcctttagccagttttcccagctctatcgcagcctg
atgtttgacgcccagaaagctatggagattccttttctacaaaggttcattgagagacca
gagcagaagatcttactagaagacttcaagactttccttctggaggcccagaaggagctg
tgggccaccgacaacaataaggtgcaggagtttatgtttgggtacctgaaggacccactg
agggaggtggaacaacccttcttccaccaagatgagttcctgacgtacctgttttccaaa
gagaacaccgtctgggactcagccctggaccaggtgtgtcctgaagacatgaacaacccc
ctgtctcattactggatatcctcatctcataacacctacctgacaggtgaccagttttct
agtgagtcgtccctggaagcgtacgcacgctgtctgaggatgggctgccgctgcatcgag
ttggactgctgggatggtccagatggaatgcctgtcatctatcatggacacaccctcacc
accaagatcaagttctgtgatgtcctggcgaccatcaaggaacacgcctttgtgacgtct
gactaccccatcatcctgtccatagaggatcattgcagcattgtccagcagaggaacatg
gctacctactttaagaaggtctttggagaaatgctgcttaccaaggctgtggacatctcc
gccgacggactgccctcacccaatcagcttaagaggaagatcctcatcaagcataagaag
ctagcagagggcagtgcctatgaggaggtgtccacctccactccctactctgagaatgac
atcagcaactccatcaagaatggcattctcttcctggaggaccccatcaaccatgagtgg
taccctcacttctttgtactgaccagcagtaagatctactactcggaggagacgtctaac
aaccaaggcaacgaggatgaggaggagcacagagagatctcgaacggtatggaccaacat
atagcagagaagtggttccatgggaagctgggtgctggtcgcgacgggagacagatagct
gagcggctgctgtcggagtactgtcttgagacgggtgctcccgacgggtccttcctggtc
cgggagagtgagacgttcgtaggagactacaccttgtccttctggcgttcaggccgggtg
caacactgtcgcatccactctcgccaagaggcgggcagccccaagttctacttgacagac
aacctggtgtttgacacgctattcgccctcatcacccactaccagcaggtagcgctgcgc
tgtaacgagtttgagatgaagctgactgagcctgtgccccagaccaacgcccacgaaagc
aaagagtggtaccatgccaacctgtctcggagccacgctgagaacatgctgatgagggtt
ccacgtgacggggcgttccttgtcagaaaaagggcagagctaagctcctttgccatttcc
ttcagggcagaggggaagatcaagcactgcagggtgcagcaggagggccagacggtggtg
ttggggacgtcggagttcgacagcctggtggatctcatcagttactacgagaagcacccg
ttgtaccgtaagatgaagctccgctaccctatcaatgaggagacgctggagaagataggc
accgctgagccagattacgggtctctgtatgaggggcggaaccctgggttctacgtcgaa
gccaatcagatgcccaccttcaagtgcacagtgaaggccatgtatgagtacaaggcccag
agggatgatgaattgtccttcagtaagaacgccatcatccaaaatgtggacaaacaggaa
ggaggctggtggaagggggactgtggtgggaagaagcagctgtggtttcctgctaactat
gtagaggagatcagtccttcagctgtggagccagacagatcacagctgacagagaacagt
cctctgggagacctgctgagaggaagtgtagatgtgtcttcctgtcagattgtggtgcgg
cctgatggtaagggaagcaggctgcatgtgttctccctcctcccagctgcctctcccagg
gcagggcaggtcttggacatcgctgccaatacccaggaggagctcaaagagtgggtcata
aagatcagagaggtcaccatgacatcagaggccaagctggaggaggggaagatgatggag
agaaggaagaagatcgctctggagctgtctgacctggtcatctactgtagacctgtaccc
ttcgacgaggacaagattgggacagagcgggcgtgtttccgggacatgtcgtcgttcccg
gagaccaaggcagagaagtatgtgaaccggatcaaggggaagaggttcttgcagtacaac
cggctgcagctgtcccgtatctaccctcgtggacagaggctggactcctccaactacgac
cctctgcccatgtggctctgtggatcccagctggtcgcgctgaacttccagactgcagac
aagcccatgcagatgaaccaggctctgttcatgttgaacgggaggagtggctacgtcctc
cagccaccaatcatgagagacgacaactttgacccctttgaccgacacacgctgaggggc
ctggagtcagtcaccctgcagatagaggtgttgggtgctcgtcacctgcctaaacacgga
cgtggcatcgtgtgcccgctgatcgagctcgaggtgtgtggcgcagaatatgacagcgcc
aagcagaagaccgactcagaggcggataatgggctgaaccccacatggcctcggaagcct
ttccagttcaccgtgtgtaactctgcctttgccttcctgcgctttgtggtgtacgagatt
gacatgttcagcgaccagaacttcctggctcaggccagcttccccatcaacagcctcaag
acaggataccggtcggtccctctgaagaacagctgtaatgaggatctggagctggcctct
ctgctggtgcacatggacatcacccggagcagggctgaaaatggggaggtgctgagcccg
ttcctgccggtaggaggtgtctctgcagcggtggttacccagacagggcgcgagcgtctg
ggggagacaggctccacgtcctcagcctcctccatgtcccctctgccccagtccccagca
gcccagacccaggctcagacacaggcctacagaggcagggagggctccttcgaggcccgc
taccagacacctctggatgacttcagagtatcacaggaggctctgctggacctggaccct
cagaacaggaggatgatgcgcaggaccagagtgggcggagagaaccgcgtttag

KEGG   Salmo salar (Atlantic salmon): 106573684
Entry
106573684         CDS       T04363                                 

Gene name
plcg2
Definition
(RefSeq) phospholipase C gamma 2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00562  Inositol phosphate metabolism
sasa01100  Metabolic pathways
sasa04012  ErbB signaling pathway
sasa04020  Calcium signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04370  VEGF signaling pathway
sasa04625  C-type lectin receptor signaling pathway
Module
sasa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106573684 (plcg2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106573684 (plcg2)
   04370 VEGF signaling pathway
    106573684 (plcg2)
   04020 Calcium signaling pathway
    106573684 (plcg2)
   04070 Phosphatidylinositol signaling system
    106573684 (plcg2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106573684 (plcg2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106573684 (plcg2)
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     106573684 (plcg2)
Membrane trafficking [BR:sasa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    106573684 (plcg2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    106573684 (plcg2)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y C2 SH3_1 SH3_9 PH SH3_2 PH_14 PH_12
Other DBs
NCBI-GeneID: 106573684
NCBI-ProteinID: XP_014004432
UniProt: A0A1S3MMM4
LinkDB
Position
ssa16
AA seq 1260 aa
MAGPGRSQQGELTEYKKSLIKRDLEMGIVMTVFRQKVERLTVQVIMETRQVAWTRTADKN
DGVLDLSEIREIRPGRNSKDFERFRDGRDKHDENTCFTIFYGSQFVLNTISLGADTVDDA
DKWLTGLELLRQETLVAPTPDIIESWLRKQMYSINQTKKNRITLKEVKSLLPQLNYKVPS
TRSLKEKFSEIGARKDVLNFEQFHKFYNILMFDQKDILEEFKRESCAFIMGSTDKPDASA
VLLHDFQRFLLYQQKESWANDLNQVRELMTTFIDDTMRKTNDPEFTVSEFLSFLFSKENS
IWDEKYSEMCNLDMNNPLSHYWINSSHNTYLTGDQLRSESSTEAYIRCLRLGCRCVELDC
WEGPGEPIIYHGWTRTTKIKFEDVVKAINDHAFVTSEYPVVLSIEEHCPIEQQRQMARIF
REVFQDKLLMEPVELMAEQLPSPTQLKGKIILKHKKLSVEGGIGGKDFRKGEKQGDLHIW
DPVDQRWNKHYCVISDDKLYYAEEEEEDELRKSPELHTSEPWFHGRMSEGRQTAERLLQE
FCAESGGRDGTFLVRESDTFVTDFTLSFWRSGRVQHCRIRSGSEGGHTFYFLTDNLHFPS
VYSLIQHYRDMPLRCHDFDLRLTEAVPRPNPHLLEGWFYSNLSRGEAEDYLLRIPRDGAF
LIRQREESDSYAITFRGDGKVKHCRIQKDGSMYVLGTTTEFESLVELVNYFRKKPLYRKI
KLRYPVTLELVSRFSTETDCASLYDIKMYVEPNEIEPSLPKSTVKALYDYRPMRTDELNF
CKGALIHSVSKDSDGWWKGDYGGKLQLFFPANYVEEVSNNIKAESQDQVMEDNPLGDMCK
GVVDISKCNVVRSAKNGKSHVMTLQMSDYDSKIHFDFAAESLEDLFEWYQVAWDITQREI
TKQHNKQLEIKQQEEVEKSEEVAMEMSDLVVYCQPRSKEKDRFVNYCYKEIRSFVENKIP
AKNKTPDFLKYNRKSLSRIYPKGQRVDSSNYDPYPLWACGCHMVALNFQTADKFTQLNSA
LFSLNGRTGYVLQPEMMRSDCYDPHLEKRKVKFTLTVRVIAARHLPKPGRSIASPFVETE
LCGHTEDNKFKTVVYRDNGLNPVWKAPPEPVTFPVHEPELTFLRFVVNEEDMFSDPNFLA
QATFPVKGIRSGYRSVPLKNGFNESIELASLLVYIDVQQVEKAEEELYSSSNQLRRRQAE
INNEIFLYDTHSSLQRSAPPQLRDDLMREFSTNETQLQKIQDTCKQKIKEKKINNSKFYS
NT seq 3783 nt   +upstreamnt  +downstreamnt
atggcggggccggggcgaagccagcagggagaactgacggagtacaagaagagtctgatc
aagagggacctggagatgggtatcgtcatgaccgtgttccgccagaaggtagagcgcctt
actgtgcaggtcatcatggagaccaggcaggtggcctggacccgaacagcagacaagaat
gatggtgtcttggatctgtctgagatacgggagattcgcccagggaggaactcaaaagac
tttgagaggttcagagatggcagggacaaacatgatgagaatacctgcttcaccatcttc
tatgggtcccaatttgttcttaacaccataagccttggcgctgacacagtggatgacgcg
gataaatggctgacaggcctggagttactgagacaggagacactggtggcccccacacca
gacatcatagagagctggttgaggaaacagatgtattctatcaatcagactaaaaagaac
cgtatcaccttgaaggaggtgaagtctcttctgccacagctcaactacaaggtccccagc
acacgttccctgaaggaaaagttctcggaaattggagcaaggaaagatgtcttgaacttt
gagcagtttcataaattctacaatattctaatgtttgatcagaaagatattctcgaggag
ttcaaaagggagtcatgtgctttcatcatgggtagtacagataaacctgatgcctctgca
gttcttctccatgatttccaacgatttcttctgtaccagcagaaggagtcatgggccaat
gacctgaaccaggttcgagagctgatgaccacctttatagatgacaccatgaggaagacc
aacgatccagagttcaccgtcagcgagttcctcagtttcctcttctctaaggagaactcg
atttgggatgagaaatactcagagatgtgcaacctggatatgaacaacccattgtcccac
tactggatcaattcctcacacaacacgtacttgactggagaccagctgcggagcgagtcg
tccaccgaggcctacattcgctgcctgcgtctgggatgccgctgtgttgagttggactgc
tgggaagggccaggtgagcccatcatataccatggctggaccaggaccaccaagatcaag
tttgaggacgtggtgaaggccatcaatgaccatgcctttgtcacatctgaataccctgtg
gttctctccatcgaggagcactgtcccatagagcaacagaggcagatggctcgtatcttc
agagaggtattccaggacaagctgctgatggagcctgtggagctgatggctgaacagctg
ccctcccccacacagctcaagggcaagatcatcctcaagcacaagaaactgagtgtggag
ggaggcatcggcggaaaggacttccggaagggagagaagcaaggagacctgcatatctgg
gatccagtggaccagcgatggaacaagcactactgtgtgatttcagatgacaagctctat
tacgcagaggaggaggaggaggatgagctcaggaagtccccagagctccacacgtctgag
ccttggttccatgggaggatgagtgaagggaggcagacagcagagaggctgcttcaggag
ttctgtgctgagtcgggaggcagggatggcaccttcctggtccgagaaagtgacaccttt
gtgacagacttcaccctctcgttctggcgcagtgggagggtccagcactgtcgtatccgc
tctggctcagagggaggacatactttctacttcctgactgataacctgcacttccccagt
gtgtactcactgatccagcactatcgcgacatgcccctccgctgccacgactttgacctg
cgcctcactgaggctgtgcctcgacccaacccacacctactggaagggtggttctatagt
aacctgagcagaggggaggcagaggactatctgttgagaatcccccgggatggagccttc
ctcatcagacagagagaggagagcgactcctacgctatcaccttcagaggtgatggcaag
gtgaagcactgtcggatccagaaggatggctctatgtacgtgctgggaactaccactgag
ttcgagagccttgtggagctggtcaactacttccgtaagaagcctctgtatcgcaagatc
aaactacgctaccctgtcacactggaactggtcagccgcttcagcacggagacagactgc
gcctcactgtatgatattaagatgtatgtggagccaaatgaaatcgagccgtcactgccg
aagagtacagttaaagctctgtacgactacagacccatgagaactgatgaactgaacttc
tgcaagggggctctgatccacagcgtgtccaaagacagcgatggatggtggaaaggggac
tatgggggaaagctgcagctatttttccctgccaactatgttgaggaagtgtccaacaat
atcaaagctgagtcacaggatcaggtcatggaggacaatcctctgggggatatgtgtaaa
ggagttgttgacatttccaagtgtaacgttgtgagatcggcaaagaatgggaagtcccat
gtcatgacacttcagatgagtgattatgacagtaagattcattttgactttgcggcagag
tcactggaagacctgtttgagtggtaccaggtggcctgggacatcacccagagagagatc
accaagcagcacaacaagcagttagagatcaagcagcaggaggaggtggagaagagtgaa
gaggttgccatggagatgtctgacctggtggtgtattgccagcctcgcagcaaggagaag
gaccgctttgtgaactactgctacaaagagatccgctcctttgtggagaacaagatcccg
gccaagaacaaaactccagacttcctgaagtacaaccgcaagtccctgagccgcatctac
cccaagggccaacgtgtagactcatcaaactacgacccttaccctctgtgggcctgtggc
tgccacatggtggcgctcaacttccagactgcagataagttcactcaactcaacagtgcc
ctcttcagccttaatggacgtacaggctacgtgctacagccagagatgatgcgctcagac
tgctatgatccacatctggagaagaggaaagtcaagttcacccttactgtcagggtgatt
gctgccagacacctgcctaagccaggccgtagcattgctagcccttttgtagagacggag
ctgtgtggacacacagaagataacaagtttaagaccgtcgtctatcgtgacaacgggctg
aacccggtgtggaaggctcctccagagccggtgacgttcccagtccatgagccagagctc
accttcctgcgctttgtggtgaatgaggaggatatgttctcagaccctaacttcctggct
caggctaccttccccgtgaagggcatccgctcagggtaccgttctgttcctctgaaaaat
ggcttcaatgagagcatagagctggcgtctttactggtctacatcgatgtgcagcaggtg
gagaaagcagaggaggagctgtactcgtcgtccaaccaactgcggaggcggcaggctgag
ataaacaacgagatcttcctgtacgacacccattccagcctgcagcgttccgccccccca
cagctccgtgacgacctcatgagagagttcagcaccaatgagacacagttacagaagatc
caagatacctgcaaacagaagataaaggaaaagaaaatcaacaacagtaaattttattcc
tga

DBGET integrated database retrieval system