KEGG   Salmo salar (Atlantic salmon): 106560529
Entry
106560529         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106560529
   04370 VEGF signaling pathway
    106560529
   04068 FoxO signaling pathway
    106560529
   04070 Phosphatidylinositol signaling system
    106560529
   04150 mTOR signaling pathway
    106560529
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106560529
  09143 Cell growth and death
   04210 Apoptosis
    106560529
   04218 Cellular senescence
    106560529
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106560529
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106560529
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106560529
   04625 C-type lectin receptor signaling pathway
    106560529
  09152 Endocrine system
   04910 Insulin signaling pathway
    106560529
   04914 Progesterone-mediated oocyte maturation
    106560529
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106560529
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106560529
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106560529
SSDB
Motif
Pfam: SH2 PI3K_P85_iSH2 DUF4201 Transcrip_act Mod_r CC2-LZ Laminin_I OB_RNB Bap31_Bap29_C
Other DBs
NCBI-GeneID: 106560529
NCBI-ProteinID: XP_013978978
UniProt: A0A1S3KK06
LinkDB
Position
ssa10
AA seq 412 aa
MYNTVWTTEKDEDDWRDVMMPYSTELIFYIEMDQPPPALPPKPAKPMTPVSSSNGVKEGA
EGSLQEAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIY
HRDGKYGFSDPLTFGSVVELINHYRHESLAQYNTKLDVKLMFPISHYQQDQLVKEDNIDA
VGKKLQEYHNQYQEKSKEYDRLYEDYTKTSQEIQMKRTAIEAFNETIKIFEEQCHTQERY
SKDYMERFHREGNDKEIESWLNHKGVRQKRINEWLGIKNENTDEGYFVSTEEDDNLPHYD
EKTWFVGDLNRTQSEDLLLGKPDGAFLIRESSKKGCYACSVVVEGEVKHCVIFSTPKGYG
FAEPYNLYSSLKDLVLHYHQTSLVQHNDSLNVRLAYPVYTQMPSSSGPSPRR
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgtacaatacagtttggactacggaaaaagacgaagatgattggagggacgtgatgatg
ccgtattccacagaattaatattttacattgaaatggaccaaccacctccagctcttcct
cccaagccggccaagcccatgactccagtgagcagcagcaacggtgtgaaggaaggggct
gagggatcgttacaggaagcagagtggtactggggagacatatcaagggaagaggtgaat
gataaactgagagacatgcctgatgggaccttcctagttcgggacgcctcaaccaaaatg
cagggtgactacactctaacactgaggaaagggggcaacaacaagttaatcaagatctac
caccgggatgggaagtatggcttctcagaccccctgacgtttggttctgttgtggagctg
atcaatcactatagacatgaatccctggcccagtacaacaccaagctagacgtcaaactc
atgttccccatctcacactaccagcaggaccagctggtgaaagaggacaacattgacgcg
gtggggaagaaactccaagaatatcacaatcaataccaggagaagagcaaggagtatgac
cggctttatgaggactacaccaagacttcacaggagattcagatgaagaggacggccatc
gaggccttcaacgagaccatcaagatctttgaggagcagtgtcacacacaggaacgctac
agcaaggactacatggagcgcttccaccgggagggcaacgacaaggagattgagagctgg
ctcaatcacaaaggagtgcgtcagaaacgaattaatgagtggctggggatcaagaacgag
aacacagatgaagggtactttgtcagtacagaggaggatgacaacctgccacactatgat
gaaaagacctggtttgtaggagatctgaacagaacccagtctgaagacctcctactgggc
aaacctgacggagctttcctcattagagagagtagcaagaaaggctgctatgcatgctct
gttgttgtggagggtgaggtgaagcactgtgtgattttcagcacaccgaagggctacggc
ttcgctgaaccttacaacctgtacagctctctgaaagacctagtcctgcactaccaccag
acctccctggtccagcacaatgactccctcaacgtccgcctggcctaccctgtctacaca
cagatgccctcctcctctggcccttccccacggagatga

KEGG   Salmo salar (Atlantic salmon): 106563018
Entry
106563018         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106563018
   04370 VEGF signaling pathway
    106563018
   04068 FoxO signaling pathway
    106563018
   04070 Phosphatidylinositol signaling system
    106563018
   04150 mTOR signaling pathway
    106563018
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106563018
  09143 Cell growth and death
   04210 Apoptosis
    106563018
   04218 Cellular senescence
    106563018
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106563018
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106563018
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106563018
   04625 C-type lectin receptor signaling pathway
    106563018
  09152 Endocrine system
   04910 Insulin signaling pathway
    106563018
   04914 Progesterone-mediated oocyte maturation
    106563018
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106563018
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106563018
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106563018
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_2 SH3_9 Laminin_I Lant_dehydr_C RNA_binding
Other DBs
NCBI-GeneID: 106563018
NCBI-ProteinID: XP_013983678
UniProt: A0A1S3KYE7
LinkDB
Position
ssa11
AA seq 728 aa
MAAEGYQYRALYDYKKEREEDINLHVGDILTVTKGALGALGYSDGLEERPEDIGWLPGFN
ETTQEKGDFPGTYVEFIGKKRISPPTPKPRPPRPLPMAPGSSKADSGDEQGSALLDLTEQ
FSLPETAPPMLARLLEAIEKKGLDNPTLYRTFTAGGGLDVRQCFDTDPPSADLDQMDLQM
LCDGLSRYLQDLPQPVILPAIYTQLVHTAQEVQSPEECAQQLRHIASAPSLPAQYWLTFH
CLLRHWSRVCHNAPKNLLSSRVLGEIFSPLLFRQQAASCEPSPDAHIKIIETLVTSEWTE
AQAAPALPPKPPKPTAPAVTNNGMNNNMALQDGEWYWGDISREEVNEKLRDTADGTFLVR
DASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNP
KLDVKLQFPVSKHQQDQVVKEDNIEAVGKKLHEYHQQYQEKNREYDRLYEEYTRTSQEIQ
MKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFRREGNDKEIQRIMGNYEKLKSRISEI
VDSKRRLEEDLKKQAADYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWL
EIKNENTEDQYSMVDDDEDLPHHDERSWKLGNINRLQAEALLRGKRDGTFLVRDSSKAGC
YACSVVVEGEVKHCVINKTPSGFGFAEPYNLYNSLKELVLHYQHTSLVQHNDSLNVTLAH
PVYAQQKR
NT seq 2187 nt   +upstreamnt  +downstreamnt
atggctgcggaaggatatcagtacagggcactttacgactacaagaaggagagagaggag
gacattaacctccatgtgggggacatcttaacagtgaccaaaggggccctgggggccctt
gggtacagcgatggcctggaggaaaggcccgaggacattggctggctgcctggctttaat
gaaaccactcaggaaaagggggacttccctgggacatatgtggagttcattgggaagaag
aggatctctcctcccactcccaagccgagaccccccagacccttacccatggccccgggc
tcttccaaggctgactctggtgatgaacaaggctcagccctactggacctgacggagcag
ttttccctcccagagacggctcctcccatgctggccaggctgctggaggccattgagaag
aaaggtctggacaatccaactctgtacagaaccttcacagccggtggtggactagatgtc
agacagtgctttgacactgatcctccctcagcagacctggaccagatggacctgcagatg
ttgtgtgacggtctgagtcggtacctgcaggaccttccccagcctgtcatcctaccagcc
atttacactcagctggtccacaccgcccaagaggtgcagagccctgaagagtgtgcccag
cagctgcgccacatcgccagcgcacccagccttccggcccagtactggctcaccttccac
tgcctgctgcgccactggtcccgggtgtgtcacaatgcacccaagaacctgctcagctcc
cgcgtgctgggagagatcttcagccccctgctcttcagacagcaggctgccagctgtgag
cccagcccagatgctcacatcaagatcattgagacccttgtgaccagcgaatggacagaa
gcccaggctgctccagccctacctcccaagccgcccaaacccacggcccctgctgtcact
aacaacggtatgaacaacaacatggcgctgcaggacggcgaatggtactggggagacatc
tcccgcgaggaggtcaacgagaagctgagggacacggccgacggtacgttcttggtccgt
gatgcctccaccaagatgcacggcgactacacgctcacgttgagaaaagggggtaacaat
aagctgatcaagatattccaccgggatgggaagtacggcttttcggaccccctgaccttc
aactcagtggtggagctcatcaaccactaccgcaacgagtcgctggcccaatacaacccc
aagctagacgtcaagctacagttccccgtctccaaacaccagcaggatcaggtggtgaag
gaggacaacatcgaggctgtggggaagaagctccacgagtaccaccagcagtaccaggag
aaaaaccgagagtacgaccgcctctacgaggagtacaccaggacgtcccaggaaatccaa
atgaagaggacagcgatcgaagccttcaacgaaaccatcaagatcttcgaggagcagtgc
caaacgcaagaacggtacagcaaagagtacattgagaagttcaggagggaaggcaatgac
aaggagatccagaggatcatgggcaactatgagaaactgaagtctcgtatcagtgagatc
gtggacagcaagcggcgtctggaggaggatctgaagaagcaggccgctgactaccgagag
atcgacaaacggatgaacagcatcaagcccgacctcatccagctccgcaagaccagggat
cagtacctcatgtggttgacccagaagggtgtcaggcagaagaagctcaacgagtggctg
gaaatcaagaacgagaacacggaagatcaatactctatggtggatgacgatgaggacctc
ccccaccacgacgagcgctcctggaagctgggaaacatcaaccggctgcaggctgaggcc
ctcctccgggggaagagagacggaacattcctggtccgagacagcagcaaggcaggatgc
tacgcctgcagtgttgttgtggaaggtgaggtgaagcactgtgtcatcaacaagacgccc
tcagggtttggcttcgccgaaccttacaacctgtacaactcgctcaaagaactggtcctc
cactatcagcacacgtcactggtccagcacaatgactctctgaatgttacgctagcgcac
cccgtctacgcacagcagaagcggtga

KEGG   Salmo salar (Atlantic salmon): 106567700
Entry
106567700         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106567700
   04370 VEGF signaling pathway
    106567700
   04068 FoxO signaling pathway
    106567700
   04070 Phosphatidylinositol signaling system
    106567700
   04150 mTOR signaling pathway
    106567700
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106567700
  09143 Cell growth and death
   04210 Apoptosis
    106567700
   04218 Cellular senescence
    106567700
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106567700
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106567700
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106567700
   04625 C-type lectin receptor signaling pathway
    106567700
  09152 Endocrine system
   04910 Insulin signaling pathway
    106567700
   04914 Progesterone-mediated oocyte maturation
    106567700
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106567700
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106567700
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106567700
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_2 SH3_9 Laminin_I Lant_dehydr_C RNA_binding PI_PP_I
Other DBs
NCBI-GeneID: 106567700
NCBI-ProteinID: XP_013992775
UniProt: A0A1S3LPM2
LinkDB
Position
ssa01
AA seq 741 aa
MAAEGYQYRALYDYKKEREEDIDLHVGDILTVTKGTLVALGYSDGLEERPEDIGWLPGFN
ETTQEKGDFPGTYVEFIGKKRISPPTPKPRPPRPLPVAPGSSKADSGDELGSALLDLTEQ
FALPETAPPMLARLLEAIEKKGLDNPTLYRTFTADGGLDVRQCFDTDPPSADLDQMDLQM
LCDGLRRYLQDLPQPVIPPAIYTQLVHTAQEVQSPKECAQLLRRIASTPSLPAQYWLTFH
CLLRHWSRVCHNAPKNLLSSRALGEIFSPMLFRQQAARWVEEREGLARTDSCEPSPDAHI
KIIETLVTSEWTEAQAAPALPPKPPKPTPPAVTNNGMNNNMVLQDAEWYWGDISREEVNE
KLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELI
NHYRNESLAQYNPKLDVKLQFPVSKHQQDQVVKEDNIEAVGKKLHEYHQQYQEKNREYDR
LYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFRREGNDKEIQRIM
GNYEKLKSRISEIVDSKRRLEEDLKKQAADYREIDKRMNSIKPDLIQLRKTRDQYLTWLT
QKGVRQKKLNEWLDIRNENTEDQYSMVDDDEDLPHHDERSWKLGNINRLQAEALLRGKRD
GTFLVRDSSKAGCYACSVVVEGEVKHCVINKTPSGFGFAEPYNLYSSLKELVLHYQHTSL
VQHNDSLNVTLAHPVYAQQRR
NT seq 2226 nt   +upstreamnt  +downstreamnt
atggccgcagaaggatatcagtacagggcactttatgattacaagaaggagcgagaggag
gacattgacctccatgtgggggacatcttaacagtgaccaaagggaccctggtggcccta
gggtacagcgacggcctggaagaaaggccagaggacattggctggctgcctggctttaat
gaaaccactcaggaaaagggagactttccagggacatatgtggagttcattgggaagaag
aggatctctcctcccactcccaagccgagaccccccagacccttacccgtggccccgggc
tcctccaaggctgactctggtgatgaactaggctccgccctcctggacctgacagagcag
tttgcgctcccagagacggctcctcccatgctggccaggctgctggaggccatcgagaag
aaaggtctggacaacccaacgctgtacaggaccttcacagccgatggtggactggatgtt
agacagtgctttgatactgatcctccgtcagcagacctggaccagatggacctgcagatg
ctgtgtgacggtctacgtcggtacctgcaggatcttccccagcctgtcatcccaccggcc
atctacactcagctggtacacaccgcccaagaggtgcagagccctaaggagtgtgcccag
ctgctgcgtcgcatcgccagcacgcccagcctgccagcccagtactggctcaccttccac
tgcctgctgcgccactggtcccgggtgtgccacaacgcgcccaagaacctgctcagctcc
cgcgccctgggcgagatcttcagccccatgctcttcagacagcaggctgccaggtgggtg
gaggagagagagggactggcgcgcacagacagctgcgagcccagcccggatgctcacatc
aagatcattgagacccttgtgactagcgaatggacagaagcacaggcggctccagcccta
cctcccaagccaccaaaacccactccccctgctgtcactaacaacggtatgaacaacaac
atggtgctgcaggacgccgagtggtactggggagacatctcccgcgaggaggtcaacgag
aagctgagggacacggccgacggtacgttcttggtccgtgacgcctccaccaagatgcac
ggcgactacactctcacgttgagaaaagggggtaacaataagctgatcaagatatttcac
cgggatgggaaatacggcttctctgaccccctgaccttcaactcggtggtggagctcatc
aaccactaccgtaatgagtccctggcccagtacaaccccaagctagacgtgaagctgcag
tttcccgtctccaaacaccagcaggatcaagtggtgaaggaggacaatatcgaggctgtg
gggaagaagctccatgagtaccatcagcagtaccaggagaagaatcgagagtacgaccga
ctctacgaggagtacaccaggacgtcccaggaaatccaaatgaaaaggacagcgatcgaa
gccttcaatgaaaccatcaagatattcgaggagcagtgccaaacgcaagagcggtacagc
aaggagtacattgagaagttcaggagggaaggcaatgacaaggagatccagaggatcatg
ggcaactatgagaagctgaagtctcgtatcagtgagatcgtggacagcaagcggcgtctg
gaggaggacttaaagaagcaggctgctgactaccgagagatcgacaaacgtatgaacagc
atcaaacccgacctcatccagctccgcaagaccagggatcagtacctcacgtggttgacc
cagaagggagtcaggcagaagaagctcaacgagtggctagacatcagaaacgagaacaca
gaagatcaatactctatggtggatgacgatgaggaccttccccaccacgacgagcgctcc
tggaagctgggcaacatcaaccggctgcaggctgaggccctcctccgggggaagagggac
ggaacattcctggttcgagacagcagcaaggcagggtgctacgcctgcagtgttgtggtg
gaaggtgaagtgaagcactgtgtcatcaacaagacgccctcggggtttggcttcgctgag
ccttacaacctgtacagctcgctcaaagaactggtcctccactaccagcacacgtcactg
gtccagcacaatgactctctgaatgtgacactagcgcaccccgtctacgcacagcagagg
cggtga

KEGG   Salmo salar (Atlantic salmon): 106568747
Entry
106568747         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform-like
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00562  Inositol phosphate metabolism
sasa01100  Metabolic pathways
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106568747
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106568747
   04370 VEGF signaling pathway
    106568747
   04068 FoxO signaling pathway
    106568747
   04070 Phosphatidylinositol signaling system
    106568747
   04150 mTOR signaling pathway
    106568747
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106568747
  09143 Cell growth and death
   04210 Apoptosis
    106568747
   04218 Cellular senescence
    106568747
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106568747
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106568747
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106568747
   04625 C-type lectin receptor signaling pathway
    106568747
  09152 Endocrine system
   04910 Insulin signaling pathway
    106568747
   04914 Progesterone-mediated oocyte maturation
    106568747
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106568747
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106568747
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106568747
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     106568747
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106568747
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 DUF5314 C2
Other DBs
NCBI-GeneID: 106568747
NCBI-ProteinID: XP_013994835
UniProt: A0A1S3LVG7
LinkDB
Position
ssa14
AA seq 1068 aa
MPPRPSSGELWGMHLMPPSIMVDCLLPNGMILTLECTREATLISVKHELFKEARKYPLHH
LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQAFLKVIEPVGNREEKILNREIGFA
IGMPICEFDLVKDAEVQDFRRNILNVCKESVDLRDTNGPISRALYVYPPNVESSVELPKH
IFNKLDKGQIIVVIWVIVSPSNDKQKYTLKINHDCVPEHVIAEAIRKKTRSMLLSHEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPLSQYKYVRSCIMLGRMPNLMLMAKDSLYSQLPID
TFTMPSYARRISTATPYMNGETATKSLWTINGTLRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEQLCDNVNTQRVPCSNPRWNEWLNYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTHTLVAGKMALNLWPVPHGLEDLLNAIGVTGSNPNKETPCLELEFDHF
SNPVKFPDMPAIEEHANWNISRELGFNYCHTGLSNRLARDNPLTDSDNEQLRLVCNRDPL
SEITEQEKDFLWRHRHYCVSIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAME
LLDCNFPDPMIRDFAVKCLEKYLTDDRLSQYLIQLVQVLKYEQYLDNPLARFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDLLK
QEKKDEAQKVQMKFLVEQMKRPDYMDALQSFTSPLNPAHQLGNLRLEECRMMSSAKRPLW
LNWENPDMMSELLFQSNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNRGEMYDQAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHAMN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctcccaggccatcttcgggggaactatggggcatgcacttgatgcccccgagcatc
atggtggactgccttctccccaatgggatgattctgacattggagtgcacacgtgaggcc
acactcatttcggtgaaacacgaactcttcaaggaggccaggaagtatcctctccaccac
ctcctgcaggaggagacctcctacatctttgtcagcgttacccaagaggctgagagagag
gagttctacgatgagacgaggagactgtgcgacctaaggctttttcaggccttcctgaaa
gtcatcgagccagtaggcaaccgagaggagaaaatactcaaccgagaaattggttttgcc
ataggaatgcctatatgtgagtttgacctggtcaaggacgcggaggtccaggactttaga
aggaacatattaaatgtctgcaaggagtctgtggacctccgagacactaacggacccatc
agtagagcgttgtacgtctaccctcccaatgtagagtcgtcagtagaactacctaagcac
atcttcaataagcttgacaaaggtcaaatcatagtggtcatatgggtcatcgtgtcaccg
agcaacgacaagcagaagtatacgctgaagatcaaccacgactgcgtgccggagcacgtg
atcgcagaggccatccgcaagaagacacgtagcatgctgctgtcccacgagcagctcaag
atgtgcgtgcaggagtatcagggcaagtacatcctcaaagtgtgcggctgtgacgagtac
ctgctggagaaataccccctgagtcaatacaagtatgtgaggagttgcatcatgctgggg
cgcatgcccaacctcatgctaatggccaaggacagcctgtactcacagctgcccatcgac
acctttaccatgccctcgtatgcccgccgcatctccacggccactccctacatgaacggc
gagacggccaccaagtctctgtggaccatcaacggcacgctgaggataaggatactgtgt
gccacctatgtcaatgtcaacatcagggacattgacaagatctacgtccggactgggatt
taccacggtggggagcagctgtgtgacaacgtgaacactcagcgcgtgccatgctcaaac
cccaggtggaacgagtggctgaactacgacatgtacattccagacatcccccgcgccgcc
cgactctgtctgtcaatctgttctgtgaaagggaggaagggggccaaagaggagcactgt
ccactagcctggggaaacatcaacctgtttgattacacccacacgctggtggctggaaag
atggccctcaacctatggcccgtgccccacggcctggaagacctgctcaatgctatcgga
gtcaccggctccaatccgaacaaggaaaccccttgcctggagctggagtttgaccacttc
agtaacccagtaaagttccccgacatgccggccatcgaggagcacgccaattggaatata
tcccgggagctgggcttcaactattgccacaccggtttgagtaacagactggcaagggac
aaccctctgacggacagcgacaacgaacagctgcgcctggtgtgtaacagagacccactg
tctgaaataactgagcaggagaaggactttctctggaggcacagacattactgcgtcagt
atcccggagatactgcccaagattctcctggcagtgaaatggaactccagggatgaggtt
gcacagatgtattgccttctaaaggactggccagccataaagccagaacaagccatggag
ttgctggactgcaacttccccgatcccatgatccgagactttgctgtgaagtgccttgaa
aaatacttaacggacgacagactctctcaatacctcattcagctggtccaggttctgaag
tacgagcagtacctcgataacccactggcccgctttctgctgaagaaggctttgaccaat
cagcggataggacatttcttcttttggcatctcaagtctgagatgcacaacaagacagtg
agccaacgttttggtctgctactggagtcctactgccgggcctgtggcatgtacctgaag
cacctgagcagacaggtggaggccatggagaagctcatcaacctcaccgacctcctcaag
caggagaagaaggacgaggcccagaaggttcagatgaagttcctggtggagcagatgaaa
aggcctgactacatggatgccctacagagcttcacctctccgctcaacccagctcaccag
ctgggaaacctccgcttggaagagtgccggatgatgtcatcggccaaacggcctctgtgg
ctcaactgggagaaccccgacatgatgtcagagctgctcttccagagcaacgagatcatc
ttcaagaatggagacgatctgaggcaggacatgctgactctgcagataattaggataatg
gagaacatctggcagaaccaggggcttgatctcaggatgttgccgtacggctgcctgtcc
atcggcgactgcgtgggcctgatcgaggtggtgaggaactcccacaccatcatgcagatc
cagtgtaaaggaggcctgaagggggcgctgcagttcaacagccacacgctgcaccagtgg
ctcaaggacaagaacaggggagagatgtacgaccaggccattgacttgttcacacggtcg
tgtgctggatactgcgtagccaccttcatcctggggatcggtgaccgacacaacagcaac
atcatggtcaaagatgatggacagctattccacatagactttggccatttcctggatcac
aagaagaagaagtttggctacaagcgagagcgggtgccttttgtcttgacacaggacttc
ttaatcgtcatcagcaaaggaacccaggagtgcacaaaaaccagggagtttgagaggttt
caggagatgtgctacaaggcctacttggccatccggcagcacgccaacctcttcatcaac
ctgttctccatgatgctgggctccggcatgcccgagctgcagtcgttcgatgacatcgcc
tacatccgcaagacccttgccctggacaagacagagcaggaggccctggactacttcatg
aagcagatgaatgacgcccaccacggcggctggaccaccaaaatggactggatcttccac
accatccgccagcacgccatgaactga

KEGG   Salmo salar (Atlantic salmon): 106568949
Entry
106568949         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106568949
   04370 VEGF signaling pathway
    106568949
   04068 FoxO signaling pathway
    106568949
   04070 Phosphatidylinositol signaling system
    106568949
   04150 mTOR signaling pathway
    106568949
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106568949
  09143 Cell growth and death
   04210 Apoptosis
    106568949
   04218 Cellular senescence
    106568949
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106568949
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106568949
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106568949
   04625 C-type lectin receptor signaling pathway
    106568949
  09152 Endocrine system
   04910 Insulin signaling pathway
    106568949
   04914 Progesterone-mediated oocyte maturation
    106568949
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106568949
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106568949
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106568949
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 Ribosomal_L22e SH3_1
Other DBs
NCBI-GeneID: 106568949
NCBI-ProteinID: XP_013995296
UniProt: A0A1S3LWS3
LinkDB
Position
ssa14
AA seq 790 aa
MAVDGFQYRALYIYTKDLEEDIDLQPGDILTVSKASLDFKEWDEERPELLGWLLGFNERT
KQRGDFPGTYVQFVGPVRMAPPPSQPRSQRPLPAAPGPDPQQAKTRRGVSWKNRGHGPGG
CCYSDWGCYSQLLRELDEEDPPSYRSWLRMDKDAFNFLLRMVEPQTRAVSLLDLTEQFTP
PETAPHTLVNLVEAIEKKGLDCKTLYRTPVASSNSESPTESWSGEVESGSDVGALSECVV
RYLRELPSPVIPPGVYPDLQAALQHGAADVAASSSGGRELSLVLERATSVPLHHRLTLQY
LLTHLGKVGQGSQLNGLDPHTLGLVFGPLLIRPSSATGWEVGEEFPALALERLLMERAMG
QEVPPPALPVKPMKAKTTTPAMTETHILSDSEWYWGEISREEVNEKMRDTPDGTFMVRDA
SSKLKGEYTLTLRKGGNNKLIKICHRGGRYGFSEPLTFTTVVELINHYRHDSLAQYNAKL
DTRLLYPISKYQQEQLVKEDSIEAVGEQLKVYHEQYQEKSREYDVLYEEYTRTSQELQMK
RTAIEAFGETIKIFEEQCETQERYSKESIEKFLREGNDKEIQKIQSNSERLKSRVTEIHD
SKRKLEQDLKQQATDNREIDKMMNSLKPDLIQLRKIRDQYLVWLTQKGTRQKSINEWLGI
KNEAEDSYSLVEEDEGSPHHDECTWYVGDIKRTQAEELLRDKCDGTFLIRESQTQKGSYA
CSVVVDGDAKHCVIYKTDKGYGFAEPYNLYGSLKDLVLHYKQESLVQHNDQLNVTLAYPV
LTQTQQQHHR
NT seq 2373 nt   +upstreamnt  +downstreamnt
atggcggtcgatggtttccaatatcgtgccctctacatctacaccaaggacttggaggag
gacattgacctgcagcccggggacattctgaccgtcagcaaggcctccctggacttcaag
gagtgggatgaggagcgtcccgagctcctgggctggctgctgggcttcaacgaacgcact
aagcagaggggggacttcccagggacatatgtccagttcgtgggccccgtgaggatggca
ccgccacccagtcagcctcgctcccaaagacccctcccagcagccccggggcctgatcca
caacaagcaaaaacaagaaggggagtgtcgtggaaaaatagaggacatggaccaggtggt
tgttgctacagtgactgggggtgctacagccagctgctgagagaactggatgaagaggac
cctccctcctatagaagctggttgaggatggacaaggatgccttcaatttcttgttgagg
atggtggagccacagaccagagctgtctctcttctggatttgaccgagcagttcacaccg
cccgaaactgctccccataccctggtgaacctagtggaggccattgagaagaaaggtctg
gactgcaagacactgtacaggacacccgtggcatcctccaactcggagagcccaacagag
agctggagtggtgaggtggagtcgggtagtgacgtgggcgccttgtcggagtgtgtggtc
cgctacctgagggagctgccgtcccctgtcatcccccccggtgtttacccagacctgcag
gctgcgctgcagcacggcgccgcggacgtggcggcaagcagcagcggaggcagggagctg
agcctggtcctggagagggccaccagtgtgcctctgcaccatcgcctcaccctgcagtac
ctgctcacacacctgggcaaggtgggccagggctcccagctcaacggcctggaccctcac
accctgggcctggtctttgggccgctgctgatccggcccagctctgccactgggtgggag
gtgggggaggagttccctgcactagcgctggagaggctgctgatggagagggccatggga
caggaagtcccgccccctgctctaccagtcaagccaatgaaggccaaaaccacgactcca
gccatgactgagactcacatactgagtgattccgagtggtactggggggaaatctccagg
gaggaggtgaacgagaagatgagagacacccctgacgggacgttcatggtccgcgacgcc
tccagcaaactgaagggagagtacacactgaccctcaggaaaggaggcaacaacaagctg
ataaagatctgccaccggggcggtcgctatggcttctccgagccgctcaccttcaccacg
gtggtggagctcatcaaccactaccgccacgattccctggcccagtacaacgccaagctg
gacacccggctcctctaccccatctccaaataccaacaggagcagctggtgaaagaggac
agcattgaggcggtgggcgagcagctgaaggtgtaccacgagcagtaccaggagaagagc
cgggagtacgacgtgctctacgaggagtacacacgcacctcacaggagctccagatgaag
cgcacggctatcgaggccttcggcgagaccatcaagatcttcgaggagcagtgtgagacc
caggagcgctacagcaaagagtccatcgagaagttcctacgcgaaggcaacgacaaggag
atccagaagatccagagcaactcagagcgtctgaagtctagggtgacggagatccacgac
agcaagagaaagctggagcaggatctgaagcagcaggccactgacaaccgagagattgac
aagatgatgaacagcctgaagccggacctcattcagctaaggaagatccgggaccagtac
ctggtatggttgacacagaaggggacgaggcagaagagtatcaatgagtggctgggcata
aagaacgaggcagaagactcatactcgctggtggaggaggacgagggctcgccccaccac
gacgagtgcacatggtacgtgggcgacatcaagcgcacccaggcagaggagctgcttagg
gacaagtgtgacggcaccttcctcatccgagagagccagacgcagaagggctcctacgcc
tgctccgtggttgtggacggcgacgccaaacactgcgtcatctacaagacggataaaggc
tacggcttcgccgagccttacaacctgtacggctccctgaaggacctggtgctccactac
aagcaagagtccctggtccaacacaacgaccagctgaatgtaaccctggcctacccagtc
ctcacccagacccagcagcagcaccacagatga

KEGG   Salmo salar (Atlantic salmon): 106569403
Entry
106569403         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106569403
   04370 VEGF signaling pathway
    106569403
   04068 FoxO signaling pathway
    106569403
   04070 Phosphatidylinositol signaling system
    106569403
   04150 mTOR signaling pathway
    106569403
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106569403
  09143 Cell growth and death
   04210 Apoptosis
    106569403
   04218 Cellular senescence
    106569403
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106569403
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106569403
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106569403
   04625 C-type lectin receptor signaling pathway
    106569403
  09152 Endocrine system
   04910 Insulin signaling pathway
    106569403
   04914 Progesterone-mediated oocyte maturation
    106569403
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106569403
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106569403
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106569403
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2
Other DBs
NCBI-GeneID: 106569403
NCBI-ProteinID: XP_013996215
UniProt: A0A1S3LZE8
LinkDB
Position
ssa14
AA seq 482 aa
MFYPSEVIFYIEMDQAPPALPPRSAKPITSFMNDNCLREAPVYPLQDAEWYWGDISREEV
NEKLRDTPDGSFLVRDASTKTQGDFTLTLRKDGHSKLIKIYHREGKYGFSEPLTFCSVVE
LIWHYQHHPLVEYNAVLDVMLTHPVSRFQQDEQVKVDSVDVAGRKLQEYHSQYQEKSQQF
DCLYEAYTKTSQEIQMKRTAIEAFNETMLIFEEQCLEQERYGEECERSIRSKGTEKDLER
FLMNYEKLKSRLGEIYDSKVHLEQDLRTQVQDYRETDRRINSLRPDLIELRNIRDEYLNW
LNHEGVQQKRINDWLGFQDNSSDNTYVLKGESERLAHHDEGSWFVGELSRTQAEEMLMDK
PTGTFLIRESSKQGCYACSVVVNVEVKHCMIYSTPRGYGFAEPYDLHCSLKELVLHYRLN
SLAQHNQALDVRLEHPVHVTPVSSALAHTATEDCLLQQTEEHHLLQTQTKLPAGLPAAAP
EM
NT seq 1449 nt   +upstreamnt  +downstreamnt
atgttttatccctctgaagtcatattctacatcgaaatggatcaggcacctccagctctc
cctcccaggtcagccaaacccattacctccttcatgaacgacaactgcctaagggaagcc
ccagtatatcccctgcaggatgccgagtggtactggggagacatttccagggaggaagtc
aacgagaagctccgcgacacacctgatggttccttcctggttcgtgacgcttccactaag
acacaaggagacttcacgctaacgctgagaaaagacgggcacagcaagctgattaagata
taccaccgtgaggggaagtatggcttttcagagcccctgaccttctgctctgtagtggag
ctcatctggcactaccagcaccatcctctggtggaatacaacgctgtactggatgtcatg
ctcacacaccccgtgtcccgcttccaacaggatgagcaggtgaaagtggacagtgttgat
gtggccgggaggaagctacaggagtaccacagtcagtaccaggagaagagtcaacagttt
gactgtctgtacgaggcctacactaaaacctcacaggagatccagatgaagagaactgcg
atagaggcctttaacgagaccatgctgatcttcgaggagcagtgtctcgagcaggagcgt
tatggggaggagtgtgagaggagcattcgatctaagggaacagagaaggacttggagaga
ttcctgatgaactatgagaagctaaagtctcggctgggggagatctatgacagtaaggtc
catctggaacaggacctgaggacccaggtccaggactacagagagacagacaggaggatc
aacagtctcaggcctgacctcatagagctacgcaacatcagagacgagtacctaaattgg
ctgaatcacgaaggtgtgcaacagaaacgcattaacgattggctggggttccaagacaat
agcagtgacaacacctacgtgttgaagggcgagagtgagagactggcacaccatgacgag
gggagctggttcgtgggcgagctaagcaggacgcaggctgaggagatgctgatggacaaa
cccaccggaaccttcctgatccgcgagagcagcaagcagggttgctacgcctgctccgta
gttgttaatgtagaagtgaagcattgcatgatttatagcacgccacgtggctatggcttc
gctgagccctacgacctccactgctctctgaaggagctcgttctgcactaccgcctcaac
tcccttgcacagcacaaccaggctctggacgtccggctggagcaccctgtccacgtcact
cctgtctcgtcagccttggcacacacagccacagaggactgcctgctacaacagacggag
gaacaccaccttctacagactcaaactaaactacctgctggactccctgcagccgctccg
gagatgtag

KEGG   Salmo salar (Atlantic salmon): 106572046
Entry
106572046         CDS       T04363                                 

Gene name
pik3cd
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00562  Inositol phosphate metabolism
sasa01100  Metabolic pathways
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106572046 (pik3cd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106572046 (pik3cd)
   04370 VEGF signaling pathway
    106572046 (pik3cd)
   04068 FoxO signaling pathway
    106572046 (pik3cd)
   04070 Phosphatidylinositol signaling system
    106572046 (pik3cd)
   04150 mTOR signaling pathway
    106572046 (pik3cd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106572046 (pik3cd)
  09143 Cell growth and death
   04210 Apoptosis
    106572046 (pik3cd)
   04218 Cellular senescence
    106572046 (pik3cd)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106572046 (pik3cd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106572046 (pik3cd)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106572046 (pik3cd)
   04625 C-type lectin receptor signaling pathway
    106572046 (pik3cd)
  09152 Endocrine system
   04910 Insulin signaling pathway
    106572046 (pik3cd)
   04914 Progesterone-mediated oocyte maturation
    106572046 (pik3cd)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106572046 (pik3cd)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106572046 (pik3cd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106572046 (pik3cd)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     106572046 (pik3cd)
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106572046 (pik3cd)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_C2 PI3K_rbd DUF4135
Other DBs
NCBI-GeneID: 106572046
NCBI-ProteinID: XP_014001244
UniProt: A0A1S3MDU7
LinkDB
Position
ssa15
AA seq 1047 aa
MPPGEYGMLGEWKKEGDHDIMMDFLLPTGIFLKFPVSRNDTIGAIKKMVWRNASSEPLYG
ALSDADAYVFTCINSTAEREELEDETRRLCDVRPFMSVLRLVAREGDRVEKLTNTQISLL
IGKGLHEFDSQKNHEVNEFRAKMRSFCEEKAQDRQRLPWYQWMEYSFSCDLEPCVSLAEP
GGIKTKGTKKIFVNVKFEASDESFMLQQEPQDLPMILMRSALKKKATVFRSVRQEKPEDY
TLQVNGRWEFIYGKYPLCQFKYIFSCLRGGQTPHLTMVHHSTIVKYQEEQGCLGSQVSKS
RSLSKPPPLPVKKQNTSSLWSIEEPFHIHLLQGYRVNADEGMKLVVQAGLFHGSELLCKV
VTSGEVNVCSEPLWDQKLVFDISVSDLPRMSRLCFALYAVIEKTKKPRSTKKKNKKADCP
LAWVNTMVFDYKDQLKTGEFLLSTWPSVPDDKGDLLNPMGTVEKNPNVDSAAGLLIRFPN
IRPHPLYYPHFDKLRDLEKNGGKVIATKVEHMKLKEIVDNKNYTEFFEDEKELLWKLRGV
VRERYPESLSKLLLITKWNKHEDVAQMVAFLQKWPDLPALHALELLDYSFPDPMVRSFTI
SCLRKLRDEELLQYLLQLVQVLKYESYLDCDLATFLLERALSNKRIGHFLFWHLKSEMHV
SSVSLRFGLILEAYCRGNIYHIKSLWKQNEALNKMKALNDFVKSGWQKTSRQQMTDDMKL
CIKQEAYMEALSYLLSPLNPSIMLSEICADRCKFMDSKMKPLWLMYKNKWVQGDAVGIIF
KNGDDLRQDMLTLQMIQLMEILWKKEGLDLRMIPYGCLSTGNKTGLIEVVKNSDTIANIQ
RNNSNSAATAAFNKDALLNWLKSKNPDRDKLDQAIEEFTLSCAGYCVATYVLGIGDRHND
NIMIKETGQLFHIDFGHFLGNFKSKFGINRERVPFILTYDFVHVIQQGRTNNSEKFERFR
ECCEQAYKILCRNGTLFVNLFAMMKAAGLPELSSFKDIQYLKDSLALGKSEEEALKNFKV
KFNEALRESWKTKVNWMMHSLAKDSRL
NT seq 3144 nt   +upstreamnt  +downstreamnt
atgcccccgggggagtatgggatgctgggcgagtggaagaaggagggggaccatgacatc
atgatggacttcctgctgcccaccgggatcttcctgaaattccctgtgtctcgcaatgac
accatcggggccatcaaaaaaatggtgtggaggaatgctagcagcgagcccctgtatgga
gcactgagcgacgcggacgcttacgtgttcacctgcatcaactcgacggcagagcgtgag
gagctagaagatgagacccgtcgtctgtgtgatgtccggcccttcatgtctgtcctgagg
ctggtggcccgggagggtgaccgcgtggagaagctcaccaacacccagatcagcctgctg
attggcaaaggtctgcacgaatttgactcccagaagaaccatgaggtgaacgagttccgg
gccaagatgcggtccttctgtgaagagaaggcccaggaccgccagcggttgccatggtac
cagtggatggagtacagcttctcgtgtgatctagagccatgtgtttccctggcagagccc
gggggcatcaagacaaaaggcactaagaagatctttgtcaatgtcaagtttgaggccagc
gatgaaagctttatgcttcagcaggagccccaggacttgccgatgatcttaatgcggagt
gccctaaagaagaaggccactgtgtttcgctcagtgcgacaggagaagccagaggactac
actttacaggtcaatgggaggtgggaattcatatacgggaaataccccctgtgccagttc
aaatacatcttctcctgtttgagagggggtcaaaccccccacctgaccatggttcatcac
tccaccattgtcaaataccaggaggagcagggctgcctgggcagccaggtgtccaagagt
cgctccttgtccaagcccccccctctacccgtgaagaagcagaacacgtcgtctttgtgg
tccattgaggagcctttccacattcacttgctacaaggctaccgtgtcaacgcagatgaa
ggaatgaagctggtcgtccaggcaggtctgttccacggcagtgagctgctgtgtaaggtg
gtgaccagcggtgaggttaacgtgtgctccgagcccctgtgggaccagaagctggtgttt
gacatcagcgtgagcgacctgcctcgtatgagccgcctgtgctttgctctctacgccgtc
attgagaagaccaagaagccccgctccaccaagaagaagaacaagaaagctgactgtcca
ctagcctgggtaaacaccatggtgtttgactataaggatcagctgaagactggggagttc
cttctctccacctggccttcagtccctgatgataaaggcgacctcttgaatccaatgggc
acagtggagaaaaatcccaacgttgatagtgcagcaggactcctcattcgcttccccaat
atccgacctcaccctctctactacccccatttcgacaagttgagggacctagaaaaaaat
ggagggaaggttatagccaccaaggtggagcatatgaagctaaaggaaatagtagacaat
aagaactacacagagttctttgaggatgagaaagagcttctgtggaagctacgcggtgtg
gtgcgggagcgctacccagagagtctgtccaaacttctcctcatcacaaaatggaataag
cacgaggatgtagcacagatggtggcgtttctgcagaaatggccggacctccctgctctc
catgccctggagctgctggactacagtttccctgacccaatggtccgctccttcaccatc
agctgcctaaggaagctgagagatgaggagctgctccagtacttgctgcagttagttcag
gttctgaagtatgagtcttacctggactgtgaccttgctactttcctgctagagagagcc
ctctccaacaagaggataggtcacttcctcttctggcatctcaagtcagaaatgcacgta
tcctcggtcagtctgcggttcggtctgattctagaggcttactgcaggggcaacatctat
cacatcaagagcttatggaaacagaacgaggctctgaacaagatgaaggctctgaatgac
tttgtgaagtcgggctggcagaagacgtcgcgccagcagatgacagacgacatgaagctg
tgtatcaaacaggaggcctacatggaggccctctcatacctgctgtccccgctcaatccc
agcatcatgctctcagagatttgtgcggacagatgcaagttcatggactccaagatgaag
cccctgtggctcatgtacaagaacaaatgggtgcagggggacgctgtgggcataatcttc
aagaacggagatgatctccgacaagacatgctgaccctccaaatgatccagctgatggaa
atcctttggaagaaagagggactggatctaaggatgatcccctacggctgcctctccacc
gggaacaagacaggcctcatcgaggtggtgaaaaactcagacaccatcgccaacatccag
cgcaacaacagcaacagtgccgctaccgctgccttcaacaaagatgccctgctcaactgg
cttaaatccaagaacccagacagggataaacttgaccaggccattgaggagttcacacta
tcatgtgctggttactgtgtagccacttacgtgttgggtatcggagatcgccacaacgac
aatatcatgatcaaggagacggggcagctgttccacattgactttgggcactttctggga
aacttcaagagcaaatttgggatcaacagggaacgtgtgccttttattctgacgtatgac
tttgtccacgtcatccaacaagggaggaccaacaacagtgagaagtttgaaaggttcaga
gagtgctgtgagcaggcctataagatcttgtgtcgcaatgggactctgtttgttaacctg
tttgccatgatgaaagcagccggactgcctgagctgagctccttcaaggacatccagtac
ctaaaggactcattggctttggggaaatcggaggaagaagcgctgaagaatttcaaagtg
aagtttaacgaagctctgagagagagctggaagaccaaggtgaactggatgatgcactct
ctagccaaagatagcagactttga

KEGG   Salmo salar (Atlantic salmon): 106573900
Entry
106573900         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106573900
   04370 VEGF signaling pathway
    106573900
   04068 FoxO signaling pathway
    106573900
   04070 Phosphatidylinositol signaling system
    106573900
   04150 mTOR signaling pathway
    106573900
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106573900
  09143 Cell growth and death
   04210 Apoptosis
    106573900
   04218 Cellular senescence
    106573900
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106573900
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106573900
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106573900
   04625 C-type lectin receptor signaling pathway
    106573900
  09152 Endocrine system
   04910 Insulin signaling pathway
    106573900
   04914 Progesterone-mediated oocyte maturation
    106573900
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106573900
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106573900
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106573900
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 pP_pnuc_1 Mod_r DUF5333 V_ATPase_I
Other DBs
NCBI-GeneID: 106573900
NCBI-ProteinID: XP_014004818
UniProt: A0A1S3MNM5
LinkDB
Position
ssa16
AA seq 726 aa
MAVEGFQFIALYVYNKDWEEDLDLQPGDILTVSKTSLTSLGLKDGDEEHPERLGWMVGVN
KRTKQRGDFPGTYVQYVGPVKLYVAPNQPLQQRPLPAAPRPQPPPAQQGTSAHEFVQPFP
PPENAPPTLVKLVEAIEKKGLECETLYRKSSSLAAGSHRQSLNFELSEPEMGQYDVQALS
EALMGFLQDLPSPIIPECVYPSLKTALQEEAELSVEETGKRLLKALEPPAVPLPGLLTLQ
YLLRHLDRVGQSSAHNGLDPHTLALLFSPLLLPAGSEEDRQVSAQVLERLLVVRAWELEE
MPPALPPKPSKTKAVASSVINGDGSKMADAEWYWGDISREEVNEKMRDMPDGTFLVRDAS
SKVQGEYTLTLRKGGNNKLIKIFHRGGKYGFSEPLTFSSVVELILHYHQESLAQYNPKLD
SRLLYPISKYQQDQVVKEDNVEAVGEQLKVYHEQYQEKSREYDVLYEEYTRTSQELQMKH
TAIEAFTETINIFEEQCETQERYSKEYIDKFHREGNSQEIDRIQSNSDKLKSRVTEIHDS
KRKLEQDLKEQATDNREIDKKMNSLKPDLMQLRKIRDQYLVWLNQKGTRQKKINEWLGIK
NDVEDLYSLVDEMDDLPHHDERTWYVGDIKRGQAEELLRGKGDGTFLIRDSQSQKGSYAC
SVVMDGDVKHCVIFKTSTGYGFAEPYNLYSSLKELVLHYRHTSLVQHNDSLNVTLACPVL
TQQQPR
NT seq 2181 nt   +upstreamnt  +downstreamnt
atggctgtagagggcttccaattcatagcgctttatgtctataacaaagactgggaggag
gaccttgacctccagccaggggacatactgaccgtcagcaagacgtcactgacatccctt
gggctcaaggatggggacgaggagcacccggagcgcctgggatggatggtgggagtcaac
aagcgcaccaagcagaggggagacttccctgggacgtatgtccagtatgtggggcctgtg
aagttgtatgtggcacccaaccagcctttgcagcagagacccctcccagcagcccccagg
cctcagcctcccccagcacagcaagggacttcagctcatgagtttgtccagccttttcca
cccccagaaaatgccccccctactttggtgaagttggtagaggccattgagaaaaaaggt
ctggagtgcgagacgctgtataggaagtctagctccttggctgctggcagtcatagacag
agcctgaactttgagctctctgagcctgagatgggccagtacgatgtccaggcgctctca
gaggccctgatgggattcctgcaggacttgccctcccccatcatcccagagtgtgtctat
cccagcctgaagactgccctgcaagaggaagcagagctgtccgtcgaggagacaggcaag
cgtttgctgaaggcgctggagcccccggccgtgcccctgccaggcctgctcaccctgcag
tacctgctcagacacttggaccgagtgggccagagctcggcccacaacggcctggaccct
cacacccttgcactcctcttcagccctctgctgctccccgctgggtcagaagaagatcgt
caggtttctgcccaggtgctggagagactgctggtggtgagggcctgggagctggaagaa
atgccaccagccctacctcccaaaccttccaaaaccaaagccgtggcatcctctgtgatc
aatggagacggcagcaagatggccgatgcagagtggtactggggagacatttccagagag
gaggtgaatgagaagatgagagacatgccggatgggactttcttggtccgagacgcctca
agcaaggtgcaaggagaatacacattgactctcagaaaagggggaaacaacaagctgatc
aagatcttccaccgaggcggcaagtacggtttctctgagccgctgaccttttcctctgtg
gtggagctcatcctgcattatcaccaggagtcgctggcccagtacaaccccaagctggac
tcacggctactgtaccccatctccaaatatcagcaggaccaggtggtgaaagaggataac
gtggaagcagtaggagagcaactgaaggtgtaccatgaacagtaccaggagaagagccgg
gaatatgacgtcttgtatgaagagtacactcgcacctctcaggagttacagatgaagcac
acggccatcgaggccttcaccgagaccatcaatatctttgaggagcagtgcgagacccaa
gagcgctacagcaaggagtacattgacaagttccacagggagggcaacagccaagagatt
gacagaatccaaagtaattcagataagctgaagtctcgtgtgactgagatccatgacagc
aagcggaagctggagcaggacctgaaggagcaggcgacggacaaccgagagatcgacaag
aagatgaacagtctgaaaccagacctcatgcagctgaggaagatcagagaccagtacctg
gtgtggctcaatcagaagggcaccagacagaagaagattaacgagtggcttgggatcaag
aacgacgtggaagacctatattctctggtggatgagatggatgacctgccgcaccatgat
gagcgcacctggtacgtgggcgacatcaagcgcggccaggccgaagagctgctaaggggc
aagggtgacggcaccttcctgatccgagacagccagtcccagaagggctcctatgcctgc
tctgtagtcatggacggggacgtcaagcactgtgtgatattcaagacctccacgggctac
ggtttcgccgagccttacaacctatacagctccctgaaagagctggttctccactacaga
cacacctccctggtccagcacaatgactcgctgaatgtaactctggcatgtcctgtccta
acccagcagcagcccagatga

KEGG   Salmo salar (Atlantic salmon): 106581359
Entry
106581359         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform-like
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00562  Inositol phosphate metabolism
sasa01100  Metabolic pathways
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106581359
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106581359
   04370 VEGF signaling pathway
    106581359
   04068 FoxO signaling pathway
    106581359
   04070 Phosphatidylinositol signaling system
    106581359
   04150 mTOR signaling pathway
    106581359
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106581359
  09143 Cell growth and death
   04210 Apoptosis
    106581359
   04218 Cellular senescence
    106581359
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106581359
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106581359
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106581359
   04625 C-type lectin receptor signaling pathway
    106581359
  09152 Endocrine system
   04910 Insulin signaling pathway
    106581359
   04914 Progesterone-mediated oocyte maturation
    106581359
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106581359
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106581359
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106581359
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     106581359
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106581359
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_C2 PI3K_rbd RWD DUF4135 Tom37_C
Other DBs
NCBI-GeneID: 106581359
NCBI-ProteinID: XP_014018841
UniProt: A0A1S3NTW2
LinkDB
Position
ssa20
AA seq 1080 aa
MPPAMTDDLDLWAAHSQLSGEDMVTVDFLLPTGIYIQMDVPREATIQHIKLLLWKQAQSY
PLFPSLGEMEGHMFECVNQAAVHEELEDETRRLCDVRPFCPMLKLVTRNCGRAERLLDSK
IGVLIGKGLHELDALQDQEVKDFRSKMFRISEEKMQRVQLMTWSEWLQACFSPQLEPGGG
ATPVTDGVNDKQAEASLKVTMHFDQSQDTASLKVWPSTSPSELMEQALRKWLTTHGPEEE
GRQAEQYVLRVSDKLEFLCGDHPLIQYKYIKACLQAKECPHLTLVQVSSVQAMFEKEISA
IGAVVNRKSSNPPLPLPPKRRGPSQVNTCVWEVSTQFKIVLIKGSKVNAEESAKVQVRAG
LFHGTELLCKPVVSSESSGRSEHVWNRTLEFDITVSDLPRMARLCFAVYAVMDKVKKQKS
TKNAHINKYQTIRKAGKVHYPVAWVNTMVFDYKGQLKTGDIILHSWSSFPDELEEMLNPI
GTIQTNPYTENCTALHIHLPDYNPHPILFPPFDKILEKAAEIAGSSDCSTMGRGGKKFHI
ELKEIMERDPLSQLCENEKDLIWTLRYDCMENFPQSLPKLLLSVKWSKHEDMAQLQALLQ
IWPKLSPRDALELLDFNYPDQYVREYAVGCLRDMSDEELSQYLLQLVQVLRYEPYYDCAL
TRFLLNRAQCNRNIGHFLFWHLRSEMHMPAVSVQFSLILEAYCRGSIPHIEVLKKQVEAL
SKLKSVNELIKLGTIKNARSKTKEAMLTKEAMMTCLRQSGYTETLSDLHSPLNPSVLLSG
INVEKCRYMDSKMKPLWIVYNNKLLGGDTLGIIFKNGDDLRQDMLTLQILRLMDLLWKEA
NLDLRIVPYGCLATGDRSGLIEVVSSADTIANIQLTSSNVAAAAAFNKDALLNWLKEKNS
GDALEKAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRSTGQLFHIDFGHILGNFKSKFG
IKRERVPFILTHDFIHVIQQGKTGNTEKFGSFRNYCEQAYLILRRNGNLFITLFALMLTA
GLPELTSVKDIQYLKDSLALGKTDDEALKQFRQKFDEALRESWTTKVNWMAHNVVKDNRS
NT seq 3243 nt   +upstreamnt  +downstreamnt
atgcctcccgccatgacagacgacctggacttgtgggcggcccactcccagctgtctgga
gaggacatggtcactgtggacttcctgttacccaccggcatctacatccagatggacgtc
cccagagaggccaccatacaacacatcaaactgctcctatggaagcaggcccagtcatac
cccctgttcccttccctgggggagatggagggccacatgtttgagtgtgtgaaccaggca
gcggtgcacgaggagctggaggatgagaccaggcgcctctgtgatgttaggcccttctgt
cccatgctcaaactggtcacacgcaactgtggccgcgcggaacgcttgctcgactccaag
atcggtgtgctcatcggaaaaggtctccacgagctggacgctctgcaggaccaggaggtg
aaggacttccgcagtaagatgttccgtatcagcgaggagaagatgcagcgtgtacagttg
atgacctggagcgagtggctgcaggcctgcttctctccgcagctggagccagggggagga
gccacacccgtcacagacggtgtcaacgacaaacaggccgaggccagcctcaaagtcacc
atgcacttcgaccagtcccaggacacagccagtctgaaggtgtggcccagcaccagtccc
agtgagctgatggaacaggcgttgaggaaatggctgacgacccacggccccgaggaggag
ggacgccaggccgagcagtatgttctaagggtcagcgataagctggagttcctctgtgga
gaccaccccctcatacagtacaagtacatcaaagcctgtctccaggctaaggagtgtccc
cacctgaccctggtccaggtcagctcggtccaggccatgttcgagaaggagatctcggcc
atcggagctgtagtcaaccgaaagagctccaacccccccttacccctgccccccaagagg
aggggcccctcgcaagtgaatacatgtgtatgggaggtgtccacccagtttaagatcgtc
ctaatcaaaggcagcaaggtgaacgctgaggagtccgccaaggtccaggtgcgtgcaggc
ttgttccacggcacagagttgttatgcaagccggtggtgagcagcgagagcagtggacgc
tcggaacacgtgtggaaccgcacgctagagttcgacatcactgtgagcgacctgccgcgc
atggcccgcctctgcttcgccgtctacgccgtcatggacaaggtcaaaaagcagaagtcc
accaagaacgcccacatcaacaagtaccagaccatccgcaaagccggcaaagtgcactac
cctgtagcctgggtgaacaccatggtgtttgactataaaggacagctgaagactggagat
atcatccttcacagctggtcttcctttcctgatgaacttgaagagatgctgaaccccata
ggaaccatccagaccaacccgtacactgagaattgtacagcactccacatccacctccct
gactacaaccctcaccccatcctattcccccccttcgacaagattctggagaaagctgca
gaaatcgctgggtcaagcgattgctcgaccatgggccgaggcggtaagaagttccacatt
gagctgaaggagatcatggagagggaccctctgtcccagctgtgtgagaacgagaaggac
ctcatctggacactacgctacgactgcatggagaacttcccccagtcactgcccaaactg
ctgctctccgtcaagtggagcaaacatgaggacatggcccagctccaggccttgctgcag
atctggcccaagctgagtcccagggacgctctggagctgcttgactttaactacccagac
cagtacgtcagagagtacgctgtgggctgcctgagggatatgagtgatgaggagttgtct
cagtatctgctccagctggtccaggtgttacgttatgaaccctactatgactgtgccctc
acccgattcctgctgaacagagctcagtgcaaccgcaacataggacacttcctcttctgg
catctcaggtcagagatgcacatgccagccgtctctgtccagttctctctcatcctggag
gcctactgtcgcggcagcatccctcacattgaggtcctgaagaaacaggtggaggctctg
agcaagctgaagtctgtgaatgagctgatcaagctgggcaccatcaagaatgcccgcagt
aagaccaaggaggccatgctcaccaaagaggccatgatgacttgtctgagacagagtggc
tacacagagaccctctctgacctgcactcccctctcaaccccagtgtcctgctctctgga
atcaatgtggagaagtgtcggtacatggactcgaagatgaagcctctgtggatcgtctac
aacaacaagctgctggggggagacaccctgggaatcatcttcaagaacggagacgacctg
agacaagacatgttgacactgcagatcttgaggttgatggacctgctatggaaggaggcc
aatctggacctcagaattgtaccttacggttgcctagcaactggggaccggtcagggctg
atcgaggtggtgtcgtcggcggataccatcgccaacatccagctgaccagcagcaacgta
gcagccgccgcagccttcaacaaggatgcgctacttaactggctcaaagagaagaactct
ggagatgctctggagaaggcgatcgaggagttcaccctgtcatgtgcaggctactgcgtg
gccacctacgtcctggggataggtgaccgccacagtgacaacatcatggtccgcagcact
ggacagctcttccacatagactttgggcatatcctggggaacttcaagtccaagtttggc
atcaagagggaacgcgtccccttcatcctgacccatgacttcatccacgtcatccaacag
ggaaagacaggcaacactgagaagtttggcagtttccgtaattactgtgaacaagcctac
ctgattctgaggcggaatgggaacctcttcatcaccctgtttgccctcatgctgactgct
ggactgcccgagctcacctccgtcaaggatatacagtacctaaaggactctctggccctg
gggaagactgacgacgaagcactgaaacagttccgccagaagtttgacgaggcgctgaga
gagagctggaccaccaaagtcaactggatggcccacaacgtggtcaaagacaaccgctcc
tag

KEGG   Salmo salar (Atlantic salmon): 106584012
Entry
106584012         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106584012
   04370 VEGF signaling pathway
    106584012
   04068 FoxO signaling pathway
    106584012
   04070 Phosphatidylinositol signaling system
    106584012
   04150 mTOR signaling pathway
    106584012
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106584012
  09143 Cell growth and death
   04210 Apoptosis
    106584012
   04218 Cellular senescence
    106584012
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106584012
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106584012
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106584012
   04625 C-type lectin receptor signaling pathway
    106584012
  09152 Endocrine system
   04910 Insulin signaling pathway
    106584012
   04914 Progesterone-mediated oocyte maturation
    106584012
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106584012
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106584012
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106584012
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 SH3_2 OB_RNB Bap31_Bap29_C DUF5638
Other DBs
NCBI-GeneID: 106584012
NCBI-ProteinID: XP_014024237
UniProt: A0A1S3P9M4
LinkDB
Position
ssa23
AA seq 747 aa
MTASDSSFQYRALFEYKRERGDDISLQPGDVLTVLKASLKDYQEGDERSPKGWLNGTNER
TKEKGDFPGTFVEYAGVVRQGLPVAKPWPRPVPPTPGGTQSSVGPGPQPPGATAAGGGGP
REAPEVCALPEQAPVALHRLIEALERQGLESEPLYRTPPASTGPPELRQALDTDPVSVDV
DQYEEAVLSDTLRGFLQDLPSPIIPAVVYSELVYTAQETQSMEDCGEKLKRILESPSVPQ
ANHQLLVHLTRHLVKVAQSEAQNQASPRLLGQVFSEAIFKHSHFSADVNPEHHVKIMEAL
IAAGGLVEMQAAPALPPKPAKPMTPVSSSNGVKEGAGGSLQEAEWYWGDISREEVNDKLR
DMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFGSVVELISHY
RHESLAQYNTKLDVKLMYPISRYQQDQLVKEDNIDAVGKKLQEYHNQYQEKSKEYDRLYE
EYTKTSQEIQMKRTAIEAFNETIKIFEEQCHTQERYSKEYIERFRREGNDKEIERIMMNY
EKLKSRLGEIHDSKIRLEQDLKTQALDNRETDKKMNSLKPDLIQLRKIRDQYLVWLNHKG
VRQKRINDWLGIKNENTDEGYFVSTEEDENLPHYDEKSWFVGDLNRTQSEDLLLGKPDGA
FLIRESSKKGCYACSVVVEGEVKHCVIYSTQRGYGFAEPYNLYSSLKDLVLHYHQTSLVQ
HNDSLNVRLAYPVYAQMPSSSGPAPRR
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgacagcctctgacagcagcttccagtaccgtgcgctctttgagtacaaacgtgaacgt
ggtgatgacatcagcctccagccgggggacgtcctgacggtcctgaaagcctccctaaag
gactaccaggaaggggacgagcgcagccccaagggatggctgaacggcaccaacgagcgg
accaaggagaagggcgactttcctgggacgtttgtggagtatgcaggggtagtgaggcag
gggctgcctgtggccaagccctggcccaggcccgtacccccaacccctgggggaacacag
agcagcgtcgggcccgggccccagcctccaggggccactgcagcaggaggtggggggcca
agggaggccccagaggtgtgtgctctgcctgagcaggctcctgtggcactacacaggctg
atagaagctctggagagacaaggcttggagagtgagccactgtaccggacacccccagcc
tccaccggacccccagaactgagacaggctcttgacacagacccagtctcagtggatgtg
gaccagtatgaagaggcagtgttgtctgatactctgaggggtttcctccaggacctgccc
tcccccatcatcccagctgtggtctacagtgaactggtctacactgcccaagaaactcag
agcatggaggactgtggcgagaagttgaagaggatcctggagtcccccagcgtgccccag
gccaaccaccagctcctggtgcacctcaccagacacctggtcaaggtggcccagagtgaa
gctcagaaccaggccagccccaggcttctaggccaggtcttcagtgaggccatcttcaaa
cactcccatttcagtgcggacgtaaacccagagcaccatgtgaagatcatggaggccctg
attgcagccgggggactggtggaaatgcaggcagccccagctcttcctcccaagccggcc
aagcccatgactccagtgagcagcagcaatggtgtgaaggagggggctggggggtcgcta
caggaagcagagtggtactggggagacatatcaagggaagaggtgaatgataagctgaga
gacatgcctgatgggaccttcttggttcgggatgcctccaccaaaatgcagggcgactac
acactaacactgaggaaaggggggaacaacaagttgatcaaaatctaccaccgggatggg
aagtatggtttctccgaccccctgacatttggttctgtggtggagctgattagtcactac
agacatgagtctctggcccagtacaacaccaagctagacgtcaaactcatgtaccccatc
tcacgctaccagcaggatcagctggtgaaagaggacaacattgacgcggtggggaagaaa
ctccaggaataccacaatcaataccaggagaagagcaaggagtacgaccggctttatgag
gaatacaccaagacctcacaggagattcagatgaagaggacggccattgaggccttcaac
gagaccatcaagatcttcgaggagcagtgtcacacgcaggagcgctacagcaaagaatac
attgagcgcttccgccgggagggtaacgacaaggagattgagaggatcatgatgaactat
gagaagcttaagtctcgtctaggtgagatccacgacagtaagattcgtctggagcaggac
ctgaagacccaggctctggacaacagagagacagacaagaagatgaacagcctcaaacct
gacctcatccagctccgcaagatcagggaccaataccttgtctggctcaatcacaaagga
gtgcgacagaaacgaattaacgactggctggggatcaagaacgagaacacagatgaaggg
tactttgtgagtacggaagaggatgaaaacctgccccactatgatgagaagagctggttt
gtaggagacctgaacagaacccagtctgaagaccttctactaggcaaacctgacggagcc
ttcctcatcagggagagcagcaagaagggctgctacgcatgctccgtagttgtggagggt
gaggttaagcactgtgtgatttacagcacgcagaggggctacggcttcgctgagccttac
aacctgtacagctctctgaaagacctggtcctgcactaccaccagacctcccttgtccag
cacaacgactcgctcaatgtgcgcctggcctaccctgtctacgcacagatgccctcatcc
tccggccctgccccacggagatga

KEGG   Salmo salar (Atlantic salmon): 106587034
Entry
106587034         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106587034
   04370 VEGF signaling pathway
    106587034
   04068 FoxO signaling pathway
    106587034
   04070 Phosphatidylinositol signaling system
    106587034
   04150 mTOR signaling pathway
    106587034
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106587034
  09143 Cell growth and death
   04210 Apoptosis
    106587034
   04218 Cellular senescence
    106587034
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106587034
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106587034
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106587034
   04625 C-type lectin receptor signaling pathway
    106587034
  09152 Endocrine system
   04910 Insulin signaling pathway
    106587034
   04914 Progesterone-mediated oocyte maturation
    106587034
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106587034
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106587034
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106587034
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 AAA_13 SH3_9 SH3_2 Transcrip_act Laminin_I V_ATPase_I Bap31_Bap29_C
Other DBs
NCBI-GeneID: 106587034
NCBI-ProteinID: XP_014030359
UniProt: A0A1S3PT14
LinkDB
Position
ssa26
AA seq 721 aa
MTSEGYQYRALYDYKKEREEDIDLHVGDILVVSKGALLALGCPNWAEEKPDEIGWLPGFN
ETTHEKGDFPGTYVEFVGRKIISPPTPKPRPPRPLPSTSDLARTDPESEGFMLPDLPEQF
APPETASPILVKLLEAIEGKGLECPTLYRTFTAACGLDMRQFTDCDLEPLDLQSLCDGLW
RYLQDLPNPVVPTSLQSEMIHAAQEVKDPKDCAQLLRRIASSPTHPPQYCLTFYCLIKHF
CRISQNTSKNQLCVRDLAEIFSPVLFRLQPASCEASLDSLIKILEILVNSELSETQAAPA
LPPKPPKATTPVPNNGFNNNMALQDGEWYWGDISREEVNEKLRDTADGTFLVRDASTKMH
GDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRHESLAQYNPKLDVRLL
YPVSRLQQDQVVKEDNIEAVGKRLQEYHLQFQEKNREYDRLYEEYTRTSQEIQMKRTAIE
AFNETIKIFEEQCQTQERYSKEYIEKFRREGNDKEIQRIMGNYDKLKSRISEIVDSKRHL
EDDLKKQAADYREIDKKMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGIKNENP
EDEYSMVEDDEDLPHHDERSWRLGNINRLQAEALLRGKKDGTFLVRDSSKAGCYACSVVV
EGEVKHCVINKSHTGYGFAEPYNLYGSLKELVLHYHHTSLVQHNDSLNVTLAYPVYTQKR
R
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgacttcagaaggataccagtacagagcactgtatgactataaaaaggagagggaggag
gacattgatttgcatgtaggcgatatacttgtggtgagcaagggtgctctgctggcccta
ggctgccctaattgggctgaagaaaaaccagatgagattgggtggctgccaggattcaat
gagacaactcatgaaaaaggtgacttccccgggacttatgttgagtttgtgggaagaaaa
ataatttcaccaccaacaccaaaaccaaggccacctaggcctcttccttccacatcagat
ctagccaggacagatccagaatcagagggcttcatgttgccagatctgccagaacagttt
gctcctccagagactgcatcacccatcctggtcaagcttttggaggcaatagaaggcaaa
ggtttggaatgtccaaccctttatagaactttcacagcagcttgtgggctggatatgaga
cagttcactgactgtgatttggagcctttggacctacagtcgctatgtgatggcctttgg
agatacctgcaggatttgcctaatccagttgttcccacctctctccaaagtgagatgatt
catgcagcgcaggaggtaaaggatccaaaggactgtgcccagttgttgcgcagaatagcc
agctcacctacccatccgccccaatactgcctcacgttctactgcctcatcaaacatttc
tgccggatttctcagaacaccagcaaaaaccaactctgtgtcagagacttggcggagatc
tttagccctgtgcttttcaggcttcaaccagcaagctgtgaggccagcctggattccctt
atcaagattctagagatcttggtcaacagtgaattgagtgaaacccaggctgctccagct
ttgcccccgaaaccaccaaaggccactaccccagttccaaacaacgggttcaacaacaac
atggccttgcaagacggggagtggtactggggagacatctcaagggaggaggtgaatgag
aagctgagagacacagctgatggtacgtttctggtccgagatgcatccaccaaaatgcat
ggagactacacactgactctgaggaaaggaggaaataacaaactgatcaaaatattccat
cgggatgggaaatacggcttctcagacccactgacattcaactcggtggttgagctcatc
aatcactacagacacgagtccttagcccagtacaacccaaagctggacgtgagactgctg
tacccagtgtcaaggctccagcaggaccaggttgttaaagaggacaacattgaagctgtt
ggtaaaaggctgcaggagtaccacctgcagttccaggagaagaaccgagagtacgatcgt
ctgtacgaggagtatacaagaacatcacaggaaattcaaatgaagagaacagccattgag
gcattcaatgaaaccattaagatctttgaggagcagtgccaaacccaagagcgctatagc
aaggagtacattgaaaagttcaggagagagggtaatgataaagaaatccaaagaatcatg
ggaaactacgacaaactgaaatcgagaataagtgagattgtggacagcaaacggcacctg
gaggatgatctgaaaaagcaagcagcagattacagggagatcgataagaagatgaacagc
atcaaacctgatctgattcagctccgcaagaccagagaccaatacctaatgtggctgaca
caaaagggagtgaggcagaagaagctgaatgaatggttgggtatcaagaatgaaaaccca
gaggatgagtactcaatggttgaagacgatgaggacctcccacatcatgatgaacgttcg
tggaggctaggcaacatcaaccggctacaggcagaagctctgctccgggggaagaaggac
ggaacattcctggtccgggacagtagcaaagctggctgctacgcctgcagtgttgttgtg
gagggtgaggtgaagcattgtgttatcaacaagagtcatacgggctatggatttgcagag
ccgtataacctgtatggctccctaaaagaactagtcctgcactaccaccacacatcactc
gtacagcacaatgattctttaaatgtcacgctcgcctacccagtttacacccagaagagg
cggtga

KEGG   Salmo salar (Atlantic salmon): 106598808
Entry
106598808         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform-like
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00562  Inositol phosphate metabolism
sasa01100  Metabolic pathways
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106598808
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106598808
   04370 VEGF signaling pathway
    106598808
   04068 FoxO signaling pathway
    106598808
   04070 Phosphatidylinositol signaling system
    106598808
   04150 mTOR signaling pathway
    106598808
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106598808
  09143 Cell growth and death
   04210 Apoptosis
    106598808
   04218 Cellular senescence
    106598808
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106598808
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106598808
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106598808
   04625 C-type lectin receptor signaling pathway
    106598808
  09152 Endocrine system
   04910 Insulin signaling pathway
    106598808
   04914 Progesterone-mediated oocyte maturation
    106598808
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106598808
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106598808
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106598808
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     106598808
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106598808
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 DUF5314 C2
Other DBs
NCBI-GeneID: 106598808
NCBI-ProteinID: XP_014045288
UniProt: A0A1S3QYV3
LinkDB
Position
ssa03
AA seq 1068 aa
MPPRPSSGELWGMHLMPPSIQVDCLLPNGMILTLVCTREATLISVKHELFKEARKYPLHH
LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQAFLKVIEPVGNREEKILNREIGFA
IGMPICEFDLVKDSEVQDFRRNILNVCKESVDLRDTNGPISRALYVYPPNVESSVELPKH
IFNKLDKGQIIVVIWVIVSPSNDKQKYTLKINHDCVPEHVIAEAIRKKTRSMLLSHEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPLSQYKYVRSCIMLGRMPNLMLMAKDSLYSQLPID
TFTMPSYARRISTATPYMNGETATKSLWTINGTLRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEQLCDNVNTQRVPCSNPRWNEWLNYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTHTLVAGKMALNLWPVPHGLEDLLNAIGVTGSNPNKETPCLELEFDHF
SNPVKFPDMPAIEEHANCNISRELGFNYCHTGLSNRLARDNPLTDSDNEQLRLVCNRDPL
SEITEQEKDFLWRHRHYCGTIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAME
LLDCNFPDPMIRDFAVKCLEKYLTDDRLSQYLIQLVQVLKYEQYLDNPLARFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDLLK
QEKKDEAQKVQMKFLVEQMKRPDYMDALQSFTSPLNPAHQLGNLRLEECRMMSSAKRPLW
LNWENPDMMSELLFQSNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNRGEMYDQAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHAMN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctcccagaccgtcttctggggaactatggggcatgcacttgatgcccccgagcatc
caggtggactgccttctcccaaatgggatgattctgacattggtgtgcacacgtgaggca
acactcatctcggtcaaacacgaactcttcaaagaggccaggaagtatcctctccaccac
ctcctacaggaggagacctcctacatctttgtcagcgttacccaagaggctgagcgagag
gagttctacgatgagacaaggagactgtgcgacctcaggctttttcaggccttcctgaaa
gtcatcgaaccagtgggcaaccgagaggagaaaatactcaaccgagaaattggttttgca
ataggaatgcctatatgcgagtttgacctggtcaaggactcggaagtgcaggactttaga
agaaacatattgaatgtctgcaaggagtctgtggacctccgagacactaatggacccatc
agtagagcattgtacgtctaccctcccaatgtagagtcgtcagtagaactgcccaagcac
atcttcaataagcttgacaaaggtcaaatcatagtggtcatctgggtcatcgtgtcgccg
agcaacgacaagcagaagtacaccctgaagatcaatcacgactgcgtgccggagcatgtg
atcgcagaggccatccgcaagaagacacgtagcatgctgctgtcccacgagcagctcaag
atgtgtgtgcaggagtatcagggaaagtacatcctcaaggtgtgcggctgtgacgagtac
ctgctggagaagtacccccttagccagtacaagtacgtgaggagttgcatcatgctgggg
cgcatgcccaacctcatgctaatggccaaggatagcctttactcccagctgcccatcgac
acctttaccatgccctcgtacgcccgacgcatttccacggcaacgccctatatgaacggc
gagacggccaccaagtccctgtggaccatcaacggcacgctgaggatcaggatactgtgc
gcaacctatgtcaatgtaaacatcagggacattgacaagatctatgtccggactgggatc
taccacggtggggagcagctgtgtgacaatgtgaacactcagcgcgtgccatgctcaaat
cccaggtggaatgagtggctgaactacgacatgtacattccagacatcccacgtgccgcc
cgcctctgtctgtccatctgctctgtgaaagggaggaagggggctaaagaggagcactgt
ccgctagcctggggcaacatcaacctgtttgactacacccacactctagtggccgggaag
atggccctcaacctgtggcctgtgccccatggcctggaagacctgctcaatgccatcgga
gtcactggctccaatccaaacaaggaaaccccttgcttggagctggagtttgatcacttc
agtaacccggtcaagttccccgacatgccggccatcgaggagcacgccaactgtaacata
tcccgggagctgggcttcaactactgccacaccggtttgagtaacagactggcgagggac
aaccccctgacggacagtgacaacgaacagctgcgcttggtgtgtaacagagacccactg
tctgaaatcactgagcaggagaaggacttcctgtggaggcacagacattactgcggcact
atcccagagatacttcccaagattctcctggcagtgaaatggaactccagagatgaggtt
gcacagatgtattgccttctgaaggactggccagccataaagccagaacaagccatggag
ttgctggactgcaacttccccgatcccatgattcgagactttgccgtgaagtgccttgag
aaatacttaacagacgacagactctctcaatacctcatccagctggtccaggttcttaag
tacgaacagtacctcgataacccgctggcccgcttcctgctgaagaaggctttgaccaat
cagcggataggacatttcttcttttggcatctaaagtcggagatgcacaacaagactgtg
agccagcggtttggcctgctgctggagtcctactgccgggcctgtggcatgtacctcaag
cacctgagcagacaggtggaggccatggagaaactcatcaaccttaccgacctcctcaag
caggagaagaaggacgaggcccagaaggttcagatgaagttcctggtggagcagatgaaa
cggcctgactacatggatgccctacagagcttcacctctccactcaacccagcgcaccag
ctgggaaacctccgcttggaagagtgccggatgatgtcatcggccaagcggcccctgtgg
ctcaattgggagaaccctgacatgatgtcagagctgctcttccagagcaacgagatcatc
tttaaaaacggagatgatctgaggcaggacatgctgactttgcagatcattagaataatg
gagaacatctggcagaaccagggccttgatctcaggatgctgccgtacggttgcctgtcc
atcggcgactgcgtgggcctgatagaggtggtgagaaactcccacaccatcatgcagatc
cagtgtaaaggaggcctgaagggggcgctgcagttcaacagccacacgctgcaccagtgg
ctcaaggacaagaacaggggggagatgtacgaccaggccattgacttgttcacacggtca
tgtgcgggctactgcgtagccaccttcatcctggggatcggtgacagacacaacagcaac
atcatggtcaaagatgatggacagctattccacatagactttggccatttcctggatcac
aagaagaagaaatttggctacaagcgagagcgggtgcccttcgtcttgacacaggacttc
ttaatcgtcatcagtaaaggaacccaggagtgcaccaaaaccagggagtttgagaggttc
caggagatgtgctacaaggcctacctggccatccggcagcacgccaacctcttcatcaac
ctgttttccatgatgctgggctcggggatgcccgaactgcagtccttcgacgacatcgct
tacatccgcaagaccctggcgttggacaagactgagcaggaggccctggactactttatg
aagcagatgaatgacgcccaccacggcggctggaccaccaagatggactggatcttccac
acaatccgccagcacgccatgaactga

KEGG   Salmo salar (Atlantic salmon): 106599005
Entry
106599005         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106599005
   04370 VEGF signaling pathway
    106599005
   04068 FoxO signaling pathway
    106599005
   04070 Phosphatidylinositol signaling system
    106599005
   04150 mTOR signaling pathway
    106599005
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106599005
  09143 Cell growth and death
   04210 Apoptosis
    106599005
   04218 Cellular senescence
    106599005
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106599005
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106599005
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106599005
   04625 C-type lectin receptor signaling pathway
    106599005
  09152 Endocrine system
   04910 Insulin signaling pathway
    106599005
   04914 Progesterone-mediated oocyte maturation
    106599005
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106599005
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106599005
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106599005
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 SH3_1 V_ATPase_I
Other DBs
NCBI-GeneID: 106599005
NCBI-ProteinID: XP_014045517
UniProt: A0A1S3R0Y4
LinkDB
Position
ssa03
AA seq 760 aa
MAVEGFQYRALYVYTKDLEEDVDLQPGDILTVSKASLLSLNFKEGDEERPELLGWLLGFN
ERTKQRGDFPGTYVQFVGHVRMSPPSSQPRSQRILPAAPGPELSQQAVSLLDLTEQFTPP
ETAPPTLVNLVDAIEKKGLDCKTLYRTRLASASDGPTQSQREEVESGPGSDVGAVSECLL
RYLRELPSPVIPPGVYPDLQAVLQQGAAGTCHISLTPACAQPVPPTNPSPAPTKQTQAIA
NWSKAVAASSSGGRELSLVLERATSMPLHHHLTLHYLLTHLGKVIQTSHLNGLDLHTLGL
VFGPLLIRPSSATGWEVGEEFPALALERLLMEMAMGQEVPHPALPAMPVKVKATTPAMTE
SSILSDSEWYWGEISREEVNEKMRDTPDGTFMVRDASSKLEGEYTLTLRKGGNNKLIKVC
HREGRYGFSEPLTFITVVELINHYRHESLAQYNAKLDTRLLYPVSKFQQEQLVKEDSTEA
VGEQLKVYHEQYQEKSWEYDMLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQCETQERY
SKETIEKFRREGNDKEIQKIQSNSERLKSRVTEIHDSKRKLEQDLKQQATDNREIDKRMN
SLKPDLMQLRKIRDQYLVWLTQKGTRQKKINEWLGIKNEAEDSYWLVEEDEGSPHHDDGT
WYMGDIKRTQAEELLRDKCDGTFLIRESQTQKGSYACSVVVDGDAKHCVIYKTDKGYGFA
EPYNLYGSLKDLVLHYKHESLVQHNDQLNVTLAYPVLTQT
NT seq 2283 nt   +upstreamnt  +downstreamnt
atggcggttgagggtttccagtaccgtgccctctacgtgtacaccaaggacttggaggaa
gatgttgatctgcaacccggggacattctgaccgtcagcaaggcctccctgctctccctg
aatttcaaggagggggacgaggagcgtcccgagctcctaggctggctgctgggcttcaac
gagcgcaccaagcagaggggggacttcccagggacatacgttcagtttgtgggccacgtg
aggatgtcaccgccatccagtcagcctcgctcccaaagaatcctcccagcagccccaggg
cctgagctgtcacagcaagctgtttctcttctggatttgaccgagcagttcacaccacca
gaaactgctccccctaccctggtgaacctagtggatgccattgagaagaaaggtctggac
tgcaagacactgtacaggacacgtctcgcatctgcctcagatggcccaacacagagccag
agagaggaggtggagtcggggcctggtagtgacgtgggcgctgtgtcggagtgtttactc
cgctacctgcgggagctgccgtcccctgtcatcccccccggtgtttacccagacctgcag
gctgtgctgcagcagggcgccgcgggtacatgccacatttcactcacccctgcttgtgcg
caaccagtgccccccaccaacccatccccagccccgacgaaacagacccaggcaatagca
aactggtccaaggctgtggcggcgagcagcagtggaggcagggagctgagcctggtcctg
gagagggccaccagcatgcccctgcatcaccacctcaccctgcactacctgctcacacac
ctgggtaaggtgatccagacctcccatcttaatggcctggaccttcacacccttggtctg
gtctttgggccgctgctgatccggcccagctccgccactgggtgggaggtgggggaggag
ttccctgcactggcactggaaaggcttctgatggagatggccatgggacaggaagtcccg
cacccagctttacctgccatgccagtaaaggtcaaagctacaactccagccatgactgag
agcagcatactgagtgattcggagtggtactggggtgaaatctccagggaggaagtgaat
gagaagatgagagacacccctgacgggacgttcatggtccgcgacgcctccagcaaactg
gagggagagtacacactgaccctcaggaaaggcggaaacaacaagctgatcaaggtctgc
caccgggaaggtcgctatggcttctcagagcctctcacctttatcacggtggtggagctc
atcaaccactaccgccatgagtccctggcccagtacaacgccaagctggacacccggctc
ctctaccctgtctccaaattccagcaggagcagctggtgaaggaggacagcactgaggcg
gtgggcgagcagctgaaggtgtaccacgagcagtaccaggagaagagctgggagtacgac
atgctctacgaggagtacacacgtacctcacaggagctccagatgaagcgcacggccatc
gaggccttcaacgagaccatcaagatcttcgaagagcagtgtgagactcaggagcgctac
agcaaagagaccatcgagaagttccgacgtgaaggcaacgacaaagagatccagaagatc
cagagcaactcggagcgtctgaagtctcgggtgacagagatccacgacagcaagaggaag
ctggagcaggacctgaaacagcaggcaaccgacaacagagagatcgacaagaggatgaac
agcctgaaaccagacctcatgcagctaaggaagatcagggaccagtacctggtatggttg
acacagaaggggacgaggcagaagaagattaatgaatggctgggcataaagaacgaggca
gaagactcctactggctggtggaggaggacgaaggctcgccccaccacgacgacggcacc
tggtacatgggcgacatcaagcgcacccaggcagaggagctgctgagggacaagtgtgac
ggcaccttcctcatccgagagagccagacgcagaagggctcctatgcctgctctgtagtt
gtggatggcgatgccaagcactgcgtcatctacaagacggacaaaggctatggcttcgcc
gagccctacaacctttacggctccctgaaggacctggtgctccactacaagcatgagtcc
ctggtccaacacaacgaccagctgaatgtaaccctggcctacccggtcctcacccagacc
tag

KEGG   Salmo salar (Atlantic salmon): 106600405
Entry
106600405         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106600405
   04370 VEGF signaling pathway
    106600405
   04068 FoxO signaling pathway
    106600405
   04070 Phosphatidylinositol signaling system
    106600405
   04150 mTOR signaling pathway
    106600405
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106600405
  09143 Cell growth and death
   04210 Apoptosis
    106600405
   04218 Cellular senescence
    106600405
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106600405
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106600405
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106600405
   04625 C-type lectin receptor signaling pathway
    106600405
  09152 Endocrine system
   04910 Insulin signaling pathway
    106600405
   04914 Progesterone-mediated oocyte maturation
    106600405
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106600405
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106600405
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106600405
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 DUF4201 Exonuc_VII_L Spc7
Other DBs
NCBI-GeneID: 106600405
NCBI-ProteinID: XP_014047195
UniProt: A0A1S3R4A8
LinkDB
Position
ssa03
AA seq 470 aa
MDQAPPALPPRSTKPMTSSMGHNCLREAPVFPLQDAEWYWGDISREEVNEKLCNTPDGSF
LVRDASTKTQGDFTLTLRKDGHSKLIKIYHREGKYGFSEPLTFSSVVELIWHYQHHPLVE
YNAVLDVMLTHPVSRFQQDDPVEEDSVDVAGRKLQEYHSQYQEKSQEFDRLYEAYSKTSQ
EIQMKRTAIDAFNETMLIFEEQCREQERYGEECERSSRSEGTEKDLESFLMNYEKLKSRL
GEIYNSKVHLEQDLRSQVQDYRETDRRINSLRPDLIELRNIRDQYFNWLNHKGVRQKRIN
DWLGIQDDSSDDTYVLKGERERLAHHDEGTWFVGELSRTQAEEMLMGKPTGTFLIRESSK
QGCYACSVVVNEEVKHCMIYSTPRGYGFAEPYDLHCSLKELVLHYRLNSLAQHNQALDVR
LVHPVHVTPVSSASPRTATEDCLLLKTEEHHLLQTSTKLPAGLPAAAPEM
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggatcaggcacctccagctctccctcctaggtcaacaaagcccatgacctcctccatg
ggccacaactgcctcagggaagccccagtctttccccttcaagatgccgagtggtactgg
ggagacatttccagggaggaagtcaacgagaagctctgcaacacacctgacggttccttc
ctagttcgtgacgcttccactaagacacaaggagacttcacgctaacgctgaggaaagac
ggccacagcaagttgataaagatctaccaccgtgaggggaagtacggattctcagagccc
ctgaccttcagctccgtggtggagctcatctggcactaccagcaccatcctctggtggag
tacaacgctgtgcttgacgtcatgctcacacaccccgtatcccgcttccaacaggatgac
ccggtggaagaggacagtgttgacgtggccgggaggaagctccaggagtaccacagtcag
tatcaggagaagagtcaagaatttgaccgtctatacgaggcctacagtaaaacctcacag
gagatccagatgaagagaacagcgatagatgccttcaatgagaccatgctgatcttcgag
gagcagtgtcgtgagcaggagcgttacggggaggagtgtgagaggagcagtcgatctgag
ggaacagagaaggacctggagagcttcctgatgaactatgagaagctgaagtctcggctg
ggggagatctacaacagtaaggtccacctggagcaggacttgaggtcccaggtccaggac
tatagagagacagacaggaggatcaacagcctcaggcctgacctcatagagctacgcaac
atcagggaccagtacttcaattggctgaatcacaaaggtgtgcgacagaaacgcattaac
gattggctggggatccaagacgatagcagtgacgacacctatgtgttgaagggggaacgg
gagaggctggcgcaccatgatgaggggacctggttcgtgggagagctgagcaggacgcag
gctgaggagatgctgatgggcaaacccaccggaaccttcctgatccgagagagcagcaag
cagggctgctacgcctgctccgtagttgtgaatgaagaagtaaagcattgcatgatctac
agcacgccacgtggttacggcttcgctgagccctacgacctccactgctctctgaaggag
ctcgttctgcactaccgcctcaactccctggcacagcacaaccaggccttggacgtccgg
ctggtgcaccccgtccacgtcacccctgtctcgtcagcttcgccccgcacagccacagag
gattgcctgctactaaagacagaggaacaccatcttctacagacttctactaaactaccc
gctggactccctgcagccgctccagagatgtag

KEGG   Salmo salar (Atlantic salmon): 106613172
Entry
106613172         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform-like
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00562  Inositol phosphate metabolism
sasa01100  Metabolic pathways
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106613172
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106613172
   04370 VEGF signaling pathway
    106613172
   04068 FoxO signaling pathway
    106613172
   04070 Phosphatidylinositol signaling system
    106613172
   04150 mTOR signaling pathway
    106613172
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106613172
  09143 Cell growth and death
   04210 Apoptosis
    106613172
   04218 Cellular senescence
    106613172
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106613172
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106613172
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106613172
   04625 C-type lectin receptor signaling pathway
    106613172
  09152 Endocrine system
   04910 Insulin signaling pathway
    106613172
   04914 Progesterone-mediated oocyte maturation
    106613172
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106613172
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106613172
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106613172
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     106613172
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106613172
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_C2 PI3K_rbd RWD DUF4135 Tom37_C
Other DBs
NCBI-GeneID: 106613172
NCBI-ProteinID: XP_014070640
UniProt: A0A1S3T220
LinkDB
Position
ssa09
AA seq 1080 aa
MPPAMTNLMDLWAAHSQLSGEDLVTVDFLLPTGIYIQMDVPREATIQHIKLLLWKQAQSY
PLFPSLGEMEGHMFECVNQAAVHEELEDETRRLCDVRPFWPMLKLVTRNCGRAERLLDSK
IGVLIGKGLHELDALQDQEVKDFRSKMFRISEEKMQQVQLMTWSEWLQACFSPQLEPGGG
ATPVTDGVNDKQAEASLKVTMHFDQSQDTASLKVWPSTSPSELMEQALRKWLTTHGPEEE
GRQAEQYVLRVSDKLEFLCGDHPLIQYKYIKACLQAKECPHLTLVQVSTVQAMFEKEISA
IGAVVNRKSSIPPLPLPPKRRGPSQVNTCVWEVSTHFKIVLIKGSKVNAEETAKVQVRAG
LFHGTELLCKPAVSSESSGRSEHVWNSTLEFDITVSDLPRMTRLCFAVYAVMDKVKKQKS
TKNAHINKYQTIRKSGKVHYPVAWVNTMLFDYKGQLKTGDIVLHSWSSFPDELEEMLNPI
GTIQTNPYTENTTALHIHLPDYNPHPILFPPFDKILEKAAEIAGSSDCLPMGRGGKKFHI
ELKEIMERDPLSQLCENEKDLIWTLRYDCMENFPQSLPKLLLSVKWSKHEDMAQLQALLQ
IWPKLSPRDALELLDFNYPDQYVREYAVGCLRDMSDEELSQYLLQLVQVLRYEPYYDCAL
TRFLLNRAQCNRNIGHFLFWHLRSEMHMPAVAVQFSLILEAYCRGSIPHIEVLKKQVEAL
SKLKSVNELIKLGTIKNARSKTKEAMLTKEAMMTCLRQSGYTETLSDLHSPLNPSVLLSG
INVEKCRYMDSKMKPLWIVYNNKLLGGDTLGIIFKNGDDLRQDMLTLQILRLMDLLWKEA
NLDLRIVPYGCLATGDRSGLIEVVSSADTIANIQLTSSNVAAAAAFNKDALLNWLKEKNS
GDALEKAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRSTGQLFHIDFGHILGNFKSKFG
IKRERVPFILTHDFIHVIQQGKTGNTEKFGSFRNYCEQAYLILRRNGNLFITLFALMLTA
GLPELTSVKDIQYLKDSLALGKTDDEALKQFRQKFDEALRESWTTKVNWMAHNVVKDNRS
NT seq 3243 nt   +upstreamnt  +downstreamnt
atgcctcccgccatgacaaacctcatggacttgtgggcagcccactcccagctgtctgga
gaggacctggtcactgtggacttcctgctacccaccggcatctacattcagatggatgtc
cccagagaggccaccatacaacacatcaaactgctcctatggaagcaggcccagtcatac
cccctgttcccttctctgggggagatggagggccacatgtttgagtgtgtgaaccaggca
gcggtacacgaggagctggaggatgagaccaggcgcctctgtgacgtcaggcccttctgg
cccatgctcaaactggtcacacgtaactgtggccgcgccgaacgcctactcgactccaag
atcggcgtgctcatcggaaaaggtctccacgagctggacgctctgcaggaccaggaggtg
aaggacttccgcagtaagatgttccgtatcagcgaggagaagatgcagcaggtacagttg
atgacctggagcgagtggctgcaggcctgcttctctccgcagctggagccagggggagga
gccacacccgtcacagacggtgtcaacgacaaacaggccgaagccagcctcaaagtcacc
atgcacttcgaccagtcccaggacacagccagtctgaaggtgtggcccagcaccagtccc
agtgagctgatggaacaggcgttgaggaaatggctgacgacccacggccccgaggaggag
ggacgccaggctgagcagtacgttctgagggtcagcgataagctggagtttctctgtgga
gaccaccccctgatacagtacaagtacatcaaagcctgtctccaggctaaggagtgtccc
cacctgaccctggtccaggtcagcacggtccaggccatgttcgagaaggagatctcggcc
atcggagctgtggtcaaccgcaagagctccatcccccccttacccctgccccccaagagg
aggggaccctcgcaagtgaatacgtgtgtatgggaggtgtctacccattttaagatcgtc
ctaatcaaaggcagcaaggtgaacgctgaggagacggccaaggtccaggtacgtgcaggc
ttgttccatggcacagagctgctgtgtaagccagcggtgagcagcgagagcagcggacgc
tccgaacacgtgtggaacagcacgctagagttcgacattaccgtgagcgacctgccgcgc
atgacccgcctctgctttgccgtctacgccgtcatggacaaggtcaagaagcagaagtcc
accaagaacgcccacatcaacaagtaccagaccatccgcaagtctggcaaagtgcactac
cctgtagcctgggtgaacaccatgctgtttgactataaaggacagctgaagactggagat
atcgtccttcacagctggtcttcctttcctgatgaacttgaagagatgctgaaccccata
ggaaccatccagaccaacccgtacactgagaacactacagcactccacatccacctccct
gactacaaccctcaccccatcctattcccccccttcgacaagattctggagaaagctgca
gagatcgccgggtcaagcgactgcttgcccatgggccgaggcggtaagaagttccacatt
gagctgaaggagatcatggagagggaccctctgtcccagctgtgtgagaacgagaaggac
ctcatctggacactacgctacgactgcatggagaacttcccccagtcactgcccaaactg
ctgctctccgtcaagtggagcaaacatgaggacatggcccagctccaggccttgctgcag
atctggcccaagctgagtcccagggatgctctggagctgcttgactttaactacccagac
cagtacgtcagagagtacgctgtgggctgcctgagggatatgagtgatgaggagttgtct
cagtatctgctccagctggtacaggtgttacgttatgaaccctactatgactgtgcactc
acccgcttcctactgaacagagcccagtgcaatcgcaacataggacacttcctcttctgg
catctcaggtcagagatgcacatgccagccgtcgctgtccagttctctctcattctggag
gcttactgtcgcggcagcatccctcacattgaggtcctgaagaaacaggtggaggctctg
agcaagctgaagtctgtaaacgagctgatcaagctgggcaccatcaagaacgcccgcagt
aagaccaaggaggccatgctcaccaaagaggccatgatgacttgtctgagacagagtggc
tacacagagacgctctctgacctgcactcccctctcaaccccagtgtcctgctctctgga
attaatgtggagaaatgtcggtacatggactctaagatgaagcctctgtggatcgtctac
aacaacaagctgctggggggagacaccctgggaatcatcttcaagaatggagacgacctg
agacaagacatgttgacactgcagatcttgaggttgatggacctgctatggaaggaggcc
aatctggacctgagaatcgtgccttacggttgcctagcgactggtgaccggtcagggctg
atcgaggtggtgtcgtcggcggataccatcgccaacatccagctgaccagtagcaacgtg
gcggccgccgcagccttcaacaaggatgcactgctcaactggctcaaagagaaaaactct
ggagatgctctggagaaggcgatcgaggagttcaccctgtcatgtgcaggctactgcgtg
gccacctacgtcctggggataggtgaccgccacagtgacaacatcatggtccgcagcact
ggacagctcttccacatagactttgggcatatcctggggaacttcaagtccaagtttggc
atcaagagggaacgtgtccccttcatcctgacccatgacttcatccacgtcatccaacag
ggaaagacgggcaacactgagaagtttggcagtttccgtaattactgtgaacaggcctac
ctgattctgaggcggaatgggaacctcttcatcaccctgtttgccctcatgctgactgct
ggactgccagagctcacctccgtcaaggatatacagtacctaaaggactctctggccctg
gggaagaccgacgacgaggcgctgaaacagttccgccagaagtttgacgaggcgctgaga
gagagctggaccaccaaagtcaactggatggcccacaacgtggtcaaagacaaccgctcc
tag

KEGG   Salmo salar (Atlantic salmon): 106613635
Entry
106613635         CDS       T04363                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106613635
   04370 VEGF signaling pathway
    106613635
   04068 FoxO signaling pathway
    106613635
   04070 Phosphatidylinositol signaling system
    106613635
   04150 mTOR signaling pathway
    106613635
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106613635
  09143 Cell growth and death
   04210 Apoptosis
    106613635
   04218 Cellular senescence
    106613635
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106613635
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106613635
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106613635
   04625 C-type lectin receptor signaling pathway
    106613635
  09152 Endocrine system
   04910 Insulin signaling pathway
    106613635
   04914 Progesterone-mediated oocyte maturation
    106613635
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106613635
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106613635
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106613635
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP Laminin_I GTP-bdg_M ANAPC5 DUF4201
Other DBs
NCBI-GeneID: 106613635
NCBI-ProteinID: XP_014071568
UniProt: A0A1S3T4P6
LinkDB
Position
ssa10
AA seq 558 aa
MGQYDTQALSEALMGFLQDLPPPVIPKSIYPSLKTTLQEEEELSVGETGRRLPKALEPPT
VPLLSLLTLHYLLRHLDRVGQSSAHNGLDPHTLAFLFSPLLLTTESEEGHQVPAQVQVLE
RLLVARAWELDQMSSALPPKPSKTNAMASSVISGDGSKMADVEWYWGDISRDEVNDKMRD
TPDGTFLVRDASSKVQGEYTLTLRKGGNNQLIKIFHQGGKYGFSEPLAFASVVELILYYH
HESLAQYNPKLDSRLLYPISKYQQDQVVKGDNVEAVGEQLKVYHEQCQEKSREYDVLYEE
YTRTSQELQMKRTAIEAFNETIKIAEEQCETQECYSKENTDQFLMEGNSKDTERIQSNWD
KLKSQVTEIHDRKRKLGQDLKEHATDNREIDKKMSSLKTDLVQLKKIRDQYLVWLNQKGT
RQKKINEWLGIKNDMEDLYSLVDEEEDVPHLDERTWYMGDIKRGQAEELLRGKGDGTFLI
RDSQSQKGSYACSVVVDGDVKHCVIFKTSTGYGFAKPYNLYSSLRELVLHYRHTSLIQHN
DLLNVTLACPVLTQQQPR
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgggccaatacgacacccaggctctctcagaggccctgatgggattcctgcaggacctg
ccaccccccgtcatcccaaagtctatctatcccagcctgaagactaccctgcaagaggaa
gaagagttgtccgtcggggagacaggcaggcgtttgccgaaggcgctggagcccccgact
gtgcccctgctgagcctgcttaccctgcattacctgctcagacacctggaccgagtgggc
cagagctcggcccacaacggcctggacccccacaccctcgcattcctcttcagccctctt
ctgctcaccactgaatcagaagaaggtcatcaggttcctgcccaggttcaagtgctggag
agactgctggtggcgagggcctgggagctggaccagatgtcatcagccctacctcccaag
ccttccaaaaccaatgccatggcatcttctgtcatcagtggggatggcagcaagatggct
gacgtagagtggtactggggagacatttccagagatgaggtgaatgacaagatgagagac
acaccagatggcactttcttggtccgagatgcctcaagcaaggtgcaaggagaatataca
ttgactctcaggaaaggaggaaacaaccagctgatcaagatcttccaccaaggaggcaag
tacggcttctctgagccgctggcctttgcttctgtggtggaactcatcctgtattatcac
cacgagtcgctggcccagtacaaccccaagctggactcacggctactgtacccaatctcc
aaatatcagcaggatcaggtggtgaaaggggacaacgtggaagcagtaggagagcaactg
aaggtgtaccacgaacagtgccaggagaagagccgggaatatgacgtcttgtatgaagag
tatactcgcacctctcaggagttacagatgaagcgcacggccatcgaggccttcaacgag
accatcaagatcgccgaggagcagtgcgagacccaagaatgctatagcaaggagaacact
gaccagttcctcatggagggaaacagcaaagatactgagagaatccaaagtaattgggat
aagctgaagtcgcaggtgactgagatccatgacaggaagaggaagctagggcaggacctg
aaggagcatgcgacggacaaccgagagattgataagaagatgagcagcctgaaaacggac
ctcgtacagctgaagaagatccgagaccagtacctggtgtggctcaatcagaagggcacc
agacagaagaagattaacgagtggctggggatcaaaaacgacatggaagacctgtattct
ctggtggatgaggaggaagacgtgccgcacctcgatgagcgcacctggtacatgggcgac
atcaagcgcggccaagccgaggagctgctgaggggaaagggtgacggcactttcctgatc
cgagacagccagtcccagaagggctcctacgcctgctctgtagttgtggacggggacgtc
aagcactgtgtgatattcaagacctccacgggctacggcttcgccaaaccctacaacctg
tacagctccctgagagagctggtgcttcactatagacacacctccctgatccagcacaat
gacttgctgaatgtaactctggcatgtcctgtcctaacccagcagcaacccagatga

KEGG   Salmo salar (Atlantic salmon): 106613931
Entry
106613931         CDS       T04363                                 

Gene name
pik3ca
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00562  Inositol phosphate metabolism
sasa01100  Metabolic pathways
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04070  Phosphatidylinositol signaling system
sasa04140  Autophagy - animal
sasa04150  mTOR signaling pathway
sasa04210  Apoptosis
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04510  Focal adhesion
sasa04620  Toll-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04810  Regulation of actin cytoskeleton
sasa04910  Insulin signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106613931 (pik3ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106613931 (pik3ca)
   04370 VEGF signaling pathway
    106613931 (pik3ca)
   04068 FoxO signaling pathway
    106613931 (pik3ca)
   04070 Phosphatidylinositol signaling system
    106613931 (pik3ca)
   04150 mTOR signaling pathway
    106613931 (pik3ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106613931 (pik3ca)
  09143 Cell growth and death
   04210 Apoptosis
    106613931 (pik3ca)
   04218 Cellular senescence
    106613931 (pik3ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106613931 (pik3ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106613931 (pik3ca)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106613931 (pik3ca)
   04625 C-type lectin receptor signaling pathway
    106613931 (pik3ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    106613931 (pik3ca)
   04914 Progesterone-mediated oocyte maturation
    106613931 (pik3ca)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106613931 (pik3ca)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106613931 (pik3ca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106613931 (pik3ca)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     106613931 (pik3ca)
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106613931 (pik3ca)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 C2 Ribosomal_S15
Other DBs
NCBI-GeneID: 106613931
NCBI-ProteinID: XP_014072233
UniProt: A0A1S3T6K9
LinkDB
Position
ssa10
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRIFVDCLLPNGMILTLECLREATLITIKHEVFKEARKYPLHH
LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDLVKDPEVQDFRRNILNVCKDSVELRDANGPHSRALYVYPPNVESTQELPKH
IHGKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSPEQLK
MCVQEYQGKYILKVCGCDEYLLEKCPLSQYKYVRSCIMLGRMPNLMLMAKDSLYSQLPMD
NFTMPSYARRISTATPYMNGESSTKSLWTINGTLRIRVLCATYVNVNIRDIDKIYVRTGI
YHGGEQMCDNVNTQRVPCSNPRWNEWLTYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNVNLFDYTHTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDYF
SSPVKFPDMTTVEGHANWTISRELGFNYCQSGQSNRVARDHALTDSDNEQLRQVCNRDPL
SEITEQEKDFLWRHRHYCVNIPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIKPEQAME
LLDCNYPDPMIRDFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDYMDALQNFTSPLNPAHQLGNIRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCMS
LGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSSTLHQWLKDKNKGEMYDLAVDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctcctaggccttcttctggtgaattatggggcatccatttgatgcccccccggatc
tttgtggactgcttgttgccaaacgggatgatactgaccctcgagtgcctccgtgaggcc
acgctcatcaccatcaaacatgaagtgttcaaggaggccaggaagtaccccctgcatcac
ctactacaggaggagacctcttacatttttgtcagtgttacgcaggaggcagagcgagag
gagttctacgatgaaactaggagactttgtgatctcaggctctttcagccttttctgaag
gtcatcgaaccggttggcaaccgagaggagaaaattctgaacagagaaattggattcgca
attggtatgcctgtttgcgagtttgacttagtaaaggaccctgaggtgcaggacttcagg
aggaatattcttaacgtctgtaaggattcagtagaactccgagatgccaacggaccccat
agtcgggctttatatgtctaccctcccaatgttgaatcgacacaagaacttccaaagcac
atccatggcaaactggacaaaggtcaaatcattgtcgtgatctgggtgattgtctcaccc
aacaatgacaagcagaaatacaccctgaagatcaaccatgattgtgtgccagaacaggtg
atagctgaggccatcaggaagaagaccaggagcatgctgttgtcccctgaacaactcaag
atgtgtgtgcaggagtaccagggcaagtacatcctcaaggtgtgcggctgtgacgagtac
ctcctggagaaatgcccactgagtcaatataagtatgtgaggagttgcatcatgcttggc
aggatgcccaacctcatgctgatggcgaaggatagcctttattctcagttacccatggac
aacttcaccatgccctcgtatgcccggcgcatctccaccgccactccgtacatgaacgga
gagtcctccaccaagtctctatggaccatcaacggaaccctgcggatacgagtgctctgt
gccacatacgtcaatgtgaacattcgggatatagataagatttatgtgcgaaccggcatc
taccatggaggggagcagatgtgtgacaacgtgaacacgcagcgtgtgccatgctctaat
cccaggtggaacgagtggctgacctacgacatgtacattcccgacatcccccgggcggcc
cgcctctgtctctccatctgctctgtgaaaggcaggaaaggggcgaaggaggagcactgt
ccactggcgtggggaaacgtcaacctgtttgactatactcacaccctggtctctggtaaa
atggctctgaacctgtggcctgtaccccatggcctggaggacctactcaaccccatcgga
gtcacaggctccaaccccaacaaggaaacgccttgtctagagctggagtttgactacttc
agcagtcctgtcaagttcccagacatgaccaccgtggagggacatgctaactggaccata
tccagggagctaggtttcaactactgccagtcaggccagagtaacagagtggcgcgagac
cacgccttaacggacagtgataacgagcagctgagacaggtgtgcaaccgagaccccttg
tctgagatcacagagcaggagaaggacttcctctggaggcacaggcactactgtgtaaat
atacctgaaatcctgcccaagatcctgctggctgtgaagtggaactccagagatgaagta
gcacagatgtattgccttctgaaggattggccagcaataaaaccagagcaagccatggag
ctgctggattgtaactatccagacccaatgatccgtgactttgctgttcggtgccttgag
aagtacttgaccgatgataaactctctcagtacctcattcagttggtccaggttctgaaa
tacgagcagtaccttgataacccactggtacgatttctactgaaaaaggccttgactaac
caaaggataggacacttctttttctggcacttaaagtccgagatgcacaataagacggtg
agtcagcggttcggcctgctgttggagtcctactgccgggcgtgtggcatgtacctgaag
cacctgagcagacaagtggaggccatggagaaactcatcaacctcactgacattctcaaa
caggagaagaaggacgagactcagaaggtgcagatgaagtttctggtggagcagatgagg
aggccagactacatggacgccctgcagaatttcacctcccccctcaaccctgcacaccag
ctgggaaacatacggcttgaggagtgcagaatcatgtcatctgccaaaagaccgctgtgg
ctcaattgggaaaaccctgacatcatgtccgagctcctcttccagaacaatgagatcata
ttcaaaaacggagacgacctgcgacaggacatgctaacacttcagatcatcagaatcatg
gagaacatttggcagaaccagggtctagacctcaggatgttgccatatggctgcatgtct
ttaggtgactgtgtggggctgatcgaggtggtgcggagctctcacaccatcatgcagatc
cagtgtaaaggtggcctgaagggggcgctacagttcaacagctcaacactacaccagtgg
ctcaaagacaagaacaagggagagatgtatgaccttgccgttgacttgtttacgcgatcc
tgtgctgggtattgcgtggcgaccttcatcctaggcatcggagacagacacaacagtaac
ataatggtgaaggatgatgggcagctttttcacatagattttggccattttctggatcac
aagaaaaagaaatttggctacaagcgagagcgagttccgtttgtcctaactcaagacttc
ttgattgtgatcagcaaagggacccaggagtgcacgaagaccagagagtttgagagattt
caggagatgtgctataaggcctacttggccattcgtcagcatgccaacctcttcatcaac
ctgttctccatgatgctgggctccgggatgcccgagctgcagtccttcgatgacattgcc
tacatccgtaaaaccctggccctggacaagactgagcaggaggccctggactacttcatg
aagcaaatgaacgacgcccaccatggcggctggaccaccaagatggactggattttccac
accatccgccagcacgcgcttaactaa

DBGET integrated database retrieval system