KEGG   Salmo salar (Atlantic salmon): 106560558Help
Entry
106560558         CDS       T04363                                 

Definition
(RefSeq) prostaglandin G/H synthase 2-like
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00590  Arachidonic acid metabolism
sasa01100  Metabolic pathways
sasa04370  VEGF signaling pathway
sasa04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106560558
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    106560558
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106560558
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     106560558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 106560558
NCBI-ProteinID: XP_013979029
UniProt: A0A1S3KL22
LinkDB All DBs
Position
ssa10
AA seq 609 aa AA seqDB search
MNGIISALLFLPLGIIFVCEGGNPCCSQPCLNRGVCTAMGSEDYECDCTRTGFYGHNCTQ
PEFFTWIKVSLKPTPNTVHYLLTNYKAFWNIINSISFLRDAIMRYVLTSRSHLIDSPPTF
NADYNYKSWEAYSNLSYYTRTLPPLPKDCPTPMGVVGKIELPDAKMLAEKLLIRRKFIPD
PQGSSLMFAFFAQHFTHQFFKSDQKMGPAFTKAKGHGVDLGHIYGENLERQHKLRLFKDG
KLKFQVLDGEVYPPTVKEVGADMHYPPHVPESHRFAVGHEAFGLVPGLMMYATIWLREHN
RVCDVLKEVHPDWDDDRLFQTSRLILIGETIKIVIEDYVQHLSGYNFKLKFDPELLFKER
FQYQNRISSEFNTLYHWHPLMPDAFHIQEQVYSYPQFVFNTSVVTTHGISNLVESFTKQI
AGRVAGGRNVPPAVMMVALKSIENSRQMRYQSLNAYRKRFSMKPYASFEDLTGEKEMAAE
LEEMYGHVDAVELYPGLLVEKPRTNAIFGETMVEMGAPYSLKGLMGNPICSPEYWKPSTF
GGSIGFDIINTASLQRLVCSNVKGPCPVASFHVPDVEDNRSNTINSSTAQSGSNDVNPTV
LLKERTTEL
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgaacggaatcatatccgcgcttctatttctgcctctgggcataatatttgtctgcgaa
ggaggcaacccttgctgttcgcaaccatgcctgaaccgcggcgtgtgtactgccatgggc
tcagaggactatgagtgcgactgcacacgcactggattctatggccacaactgcacacaa
cctgaatttttcacgtggattaaagtgtctctgaagcctaccccgaacacagtgcattat
ctcctcaccaactacaaggcgttctggaacatcatcaacagcatttcattcctcagggat
gctatcatgagatatgttctgacatcccgctctcatctgatcgacagtccaccgaccttc
aatgcggactataattataaaagctgggaagcctactccaacctgtcctactacacacgc
accctccctcctctgcccaaggattgcccaacccctatgggagtcgtaggtaagatagag
ctacctgatgctaagatgctggctgagaagctcctgatcaggaggaaatttatccccgac
ccccagggttccagcctgatgtttgcttttttcgcccaacacttcacccaccagttcttc
aaatctgaccagaagatggggccggcattcactaaagccaagggccacggggtggacctt
ggtcacatctacggggaaaaccttgagaggcaacacaaactgcggctcttcaaggatggc
aagctgaagtttcaggtgctggatggagaggtgtacccacctacggtgaaagaggtaggg
gctgatatgcactaccctccccatgtccctgagtctcaccgcttcgctgtgggccatgag
gcgttcggcctggtgcctggtctcatgatgtacgctactatctggctgagggaacacaac
cgcgtctgtgatgtcctgaaggaggtccacccggactgggatgatgataggctcttccag
acatcgcgtctcattctcattggtgagaccatcaagattgtgattgaggactacgtgcag
cacctgagcggctacaacttcaagctgaagttcgacccagagcttctcttcaaagagcgt
ttccagtatcagaaccgcatctcgtcagagttcaacaccctgtaccactggcacccactg
atgcctgatgccttccacatccaggagcaggtctactcctacccacagtttgtcttcaac
acctctgtggtcaccacacacggcatctccaacctagtggaatccttcaccaagcagatc
gctggacgggttgctggaggtcgtaacgtcccccctgcagtgatgatggtagctctgaag
tccatagagaacagcagacagatgcgctaccagtccctcaacgcctataggaaacgcttc
tccatgaagccatacgcctccttcgaagacctcacaggagaaaaggagatggctgcagag
ctggaggagatgtatgggcatgtggatgctgtggagctctacccaggtctgctggtggag
aagcccagaaccaatgccatctttggggagaccatggtggagatgggtgccccctattct
ctgaaaggcctgatgggaaaccccatttgctcaccagagtactggaagcccagcaccttt
ggcgggagcatcggctttgacatcatcaacaccgcgtccttacagaggctggtgtgcagc
aacgtcaagggcccctgccctgtggcatcctttcatgtgcccgacgtagaagacaataga
tccaataccatcaattccagtacagcacagtcggggagcaacgatgtcaaccccacagta
cttctgaaagaaaggaccactgagctctga

DBGET integrated database retrieval system