KEGG   Salmo salar (Atlantic salmon): 106560862
Entry
106560862         CDS       T04363                                 

Gene name
siah1
Definition
(RefSeq) siah E3 ubiquitin protein ligase 1
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106560862 (siah1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106560862 (siah1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106560862 (siah1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sasa04121]
    106560862 (siah1)
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106560862 (siah1)
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    106560862 (siah1)
SSDB
Motif
Pfam: Sina
Other DBs
NCBI-GeneID: 106560862
NCBI-ProteinID: XP_013979717
UniProt: A0A1S3KM78
LinkDB
Position
ssa10
AA seq 335 aa
MSGRANVQPMNSWKGVLKLFTCIASRTTTNKPKELPTFQEKKKALFGNLMDEEMSRQTAT
ALPTGTSKCAPSQRVPTLSGTTASNSDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRP
KLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEVTLPHTDKAEHEELCEFRPYS
CPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGF
HFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGI
ATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgtcgggtagagctaatgttcagcccatgaactcatggaagggggtgctcaagctcttc
acatgcatagcttctagaacaaccaccaacaaacctaaagagttacccacatttcaagag
aagaagaaagccttatttgggaatcttatggacgaagaaatgagtcgccagaccgccaca
gcgctgcccacaggaacctccaagtgtgccccctcccagcgcgtccccaccttgtccggc
actacggcctctaacagcgacctagctagcctgtttgagtgccccgtctgcttcgactat
gtgttgccccccatcctgcagtgccagagcggccacctggtctgcagcaactgccgaccc
aagctcacctgctgccccacctgccggggcccgctgggctccatcaggaacctggccatg
gagaaggtggccaactctgtgctgttcccctgcaagtatgcgtcgtcgggctgcgaggtg
acgctgccccacacagacaaggcagagcacgaggagctgtgtgaattccgtccgtactcc
tgcccctgcccaggggcttcctgtaagtggcagggctcgttggacgcggtcatgccccac
ctcatgcaccagcacaaatccatcaccacgctgcagggcgaggacattgtgttccttgcc
acagacattaacctgcctggggcagtggactgggtcatgatgcagtcctgcttcggtttc
cacttcatgctggtcctggagaagcaggagaagtacgacggtcaccagcagttctttgcc
atcgtgcagctgatcggcacgcggaagcaggcagagaactttgcctaccgcctggagctc
aatgggcaccggcgacggctcacctgggaggccacgccccgctccatccacgagggcatc
gccactgccattatgaacagcgactgcctagtgtttgacacctccatcgcgcagctgttt
gctgagaacggaaacctgggcatcaacgtcaccatatccatgtgctga

KEGG   Salmo salar (Atlantic salmon): 106573709
Entry
106573709         CDS       T04363                                 

Definition
(RefSeq) E3 ubiquitin-protein ligase Siah1-like
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04120  Ubiquitin mediated proteolysis
sasa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    106573709
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106573709
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    106573709
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sasa04121]
    106573709
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     106573709
Ubiquitin system [BR:sasa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    106573709
SSDB
Motif
Pfam: Sina
Other DBs
NCBI-GeneID: 106573709
NCBI-ProteinID: XP_014004478
UniProt: A0A1S3MML8
LinkDB
Position
ssa16
AA seq 342 aa
MKSSLTLPMSGRVNVQPVNSWKGVLKLFTCIATRTANNPKEVPTFQEKKKALFGNLMDEE
MSRQTATALPTGTSKCAPSQRIPTLSGTTASNSDLASLFECPVCFDYVLPPILQCQSGHL
VCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEVTLPHTDKAEHEEL
CEFRPYSCPCPGASCKWQGSLDAVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVM
MQSCFGFHFMLVLEKQEKYDGHQQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATP
RSIHEGIATAIMNSDCLVFDTSIAQLFAENGNLGINVTISMC
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgaagagttccctcactctccctatgtcgggcagagttaatgtgcagcctgtgaactca
tggaagggggtgctcaagctcttcacatgcatagccactagaacagccaacaaccccaaa
gaggtccccacatttcaagagaagaagaaagccttatttgggaatcttatggacgaagaa
atgagtcgccagaccgccacagcgctgccaacaggaacctccaagtgcgccccctcccag
cgcatccccaccctgtccggcactacagcctctaacagcgacctagccagcctgtttgag
tgccctgtctgcttcgactatgtgctgccccccatcctgcagtgccagagcggccacctg
gtctgcagcaactgccggcccaagctcacctgctgccccacctgccggggcccgctgggc
tccatccggaacctggccatggagaaggtggccaactctgtgctcttcccctgcaagtat
gcgtcgtcgggctgcgaggtaacactgccccacacagacaaggcggagcacgaggagctg
tgtgagttccggccgtactcctgcccctgcccaggggcctcctgtaagtggcagggctcg
ttggacgcggtaatgccccacctcatgcaccagcacaaatccatcaccacgctgcagggc
gaggacatcgtgttcctggctacagacattaacctgcctggggcagtggactgggtcatg
atgcagtcctgctttggtttccacttcatgctggtcctggagaagcaggagaagtacgac
ggtcaccagcagttctttgccattgtgcagctaatcggcacgcggaagcaggcagagaac
tttgcctaccgcctggagctcaacgggcaccggcgacggctcacctgggaggccacgccc
cgctccatccacgagggcattgccacggccattatgaacagcgactgcctggtgtttgac
acctccatcgcgcagctgtttgctgagaacgggaacctgggcatcaatgtcaccatatcc
atgtgctga

DBGET integrated database retrieval system