KEGG   Salmo salar (Atlantic salmon): 106560990
Entry
106560990         CDS       T04363                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106560990 (cdkn1b)
   04068 FoxO signaling pathway
    106560990 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106560990 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106560990
NCBI-ProteinID: XP_013979976
UniProt: A0A1S3KMM6
LinkDB
Position
ssa10
AA seq 182 aa
MSNVRVSNGSPTFERTDARFSDHPKPSACRNLFGPVDHEELRRDLKGHLQEIEETSSAKW
NFDFSSQTPLLNGRFEWELVDSKDIPRFYSRTQRSAKGLCPSGNNNVDLNGNSCVTPPQP
SENTERSESKEQCTGQRKRPACHDPSSQNKRSHNSSDEVTRCPALAHSVEHTPRKTSPRT
QT
NT seq 549 nt   +upstreamnt  +downstreamnt
atgtcaaatgttcgtgtttcaaatgggagccctacatttgaaaggaccgatgctcggttt
tcggatcaccccaaaccgtcagcctgcagaaaccttttcggcccggtggatcacgaagag
ttaaggagggatttaaagggacatttgcaagagatcgaagagacgtcctcagcgaaatgg
aacttcgatttttcaagtcaaacacccctattaaacgggagattcgaatgggaattagtg
gatagtaaagacattccgcgtttctacagcagaactcaacgatcggcaaagggcctttgc
ccctctgggaataataatgtggatcttaatgggaatagttgtgtgactccaccgcagccc
tctgaaaacacagaaaggtcggagagcaaagagcagtgcaccgggcagagaaaaagacca
gcctgccacgacccctcgtcccaaaataaaaggtcacacaacagttcggatgaagttact
cgttgcccagccttggcgcattctgtagaacatacacccaggaaaaccagtcccaggact
caaacgtga

DBGET integrated database retrieval system