KEGG   Salmo salar (Atlantic salmon): 106560990
Entry
106560990         CDS       T04363                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106560990 (cdkn1b)
   04068 FoxO signaling pathway
    106560990 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106560990 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106560990
NCBI-ProteinID: XP_013979976
UniProt: A0A1S3KMM6
LinkDB
Position
ssa10
AA seq 182 aa
MSNVRVSNGSPTFERTDARFSDHPKPSACRNLFGPVDHEELRRDLKGHLQEIEETSSAKW
NFDFSSQTPLLNGRFEWELVDSKDIPRFYSRTQRSAKGLCPSGNNNVDLNGNSCVTPPQP
SENTERSESKEQCTGQRKRPACHDPSSQNKRSHNSSDEVTRCPALAHSVEHTPRKTSPRT
QT
NT seq 549 nt   +upstreamnt  +downstreamnt
atgtcaaatgttcgtgtttcaaatgggagccctacatttgaaaggaccgatgctcggttt
tcggatcaccccaaaccgtcagcctgcagaaaccttttcggcccggtggatcacgaagag
ttaaggagggatttaaagggacatttgcaagagatcgaagagacgtcctcagcgaaatgg
aacttcgatttttcaagtcaaacacccctattaaacgggagattcgaatgggaattagtg
gatagtaaagacattccgcgtttctacagcagaactcaacgatcggcaaagggcctttgc
ccctctgggaataataatgtggatcttaatgggaatagttgtgtgactccaccgcagccc
tctgaaaacacagaaaggtcggagagcaaagagcagtgcaccgggcagagaaaaagacca
gcctgccacgacccctcgtcccaaaataaaaggtcacacaacagttcggatgaagttact
cgttgcccagccttggcgcattctgtagaacatacacccaggaaaaccagtcccaggact
caaacgtga

KEGG   Salmo salar (Atlantic salmon): 106575072
Entry
106575072         CDS       T04363                                 

Gene name
CDN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106575072 (CDN1B)
   04068 FoxO signaling pathway
    106575072 (CDN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106575072 (CDN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106575072
NCBI-ProteinID: XP_014006704
UniProt: A0A1S3MU61
LinkDB
Position
ssa17
AA seq 188 aa
MCNNMSNVSLSNGSPTLERVDPRPTDHTKPQICRNLFGSEDHDEFGRECLVQMKEMEKVF
IHKWNFDFLNDEPLPQGDYKWEPMKSSDMPDFYSRPPHKRVWSSGNLDHNGSHDNGVRPS
CPANGAELSEKSERQTDCHHSHNGGRKRPANPEPQSTCKKLHSREEDEVVSKSVEQTPSK
NDSRTHEH
NT seq 567 nt   +upstreamnt  +downstreamnt
atgtgcaacaacatgtcaaatgttagtctttcgaatgggagtccgacgttggaaagggtg
gatccgcgtccgacggatcacacgaagccccagatttgcagaaatcttttcggatcggag
gatcatgacgaatttgggagggagtgtttggttcaaatgaaagagatggagaaggttttt
attcacaaatggaattttgattttctaaacgacgagccccttccccagggagattataaa
tgggagccgatgaaaagcagtgacatgccagacttttacagcagaccgcctcataagcga
gtctggtcctctggaaatctggaccataacgggagtcatgataacggagtccgaccgagc
tgtcctgcgaacggggctgagctatccgagaagagcgagaggcagacggattgtcaccac
tctcacaacgggggaaggaaaagacctgcaaatccagaaccccaaagtacatgtaaaaag
ttgcattcccgtgaagaggatgaagttgtgtcaaagtcagtagagcagacacccagcaaa
aacgattccaggacacatgaacactaa

KEGG   Salmo salar (Atlantic salmon): 106584490
Entry
106584490         CDS       T04363                                 

Gene name
CDN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106584490 (CDN1B)
   04068 FoxO signaling pathway
    106584490 (CDN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106584490 (CDN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106584490
NCBI-ProteinID: XP_014025335
UniProt: B5X3A2
LinkDB
Position
ssa23
AA seq 190 aa
MSDVRLSNGSPTLERTDARLSDHPKPSACRIIFGSPDREELRRDLKGHLQEMEAAASAKW
NFDFSSHTPLSNGRFKWELMDCKDIPNFYTRTQQSVKDVCPSGNNNMDLNGNHSCVVVTP
RQPTDNTERSESQMESKEQCTGRRKRPACYEYPSSQNKRSHSSSNEVTPCPGLTHSVEKT
PRKASPRTQT
NT seq 573 nt   +upstreamnt  +downstreamnt
atgtcagatgttcgactttcaaatgggagcccgacgttggaaaggacggatgctcggttg
tcggatcaccccaaaccgtcagcctgcagaatcattttcggctcgccggatcgcgaagag
ttaaggcgggatttaaagggacatttgcaggagatggaagcggcggcctcagcgaagtgg
aacttcgatttttcaagtcacacacctctatcgaacgggagattcaaatgggaattaatg
gattgtaaagacattccaaatttctacaccagaacgcaacaatcagtgaaagacgtttgc
ccctctgggaataacaatatggatctaaatgggaatcatagttgtgtggtggtgactccc
cggcagcccactgacaacaccgagaggtcagagagccaaatggagagtaaagagcaatgc
accgggcggagaaaaagacccgcctgctatgaatacccctcgtcccaaaataaaaggtca
cacagtagttcgaatgaagttactccttgcccaggcttgacgcattcagtagaaaaaaca
cccaggaaagccagtcccaggactcaaacgtga

KEGG   Salmo salar (Atlantic salmon): 106609100
Entry
106609100         CDS       T04363                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106609100
   04068 FoxO signaling pathway
    106609100
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106609100
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106609100
NCBI-ProteinID: XP_014062979
UniProt: A0A1S3SF51
LinkDB
Position
ssa07
AA seq 191 aa
MCNNMSNVSLSNGSPTLERVDPRPTDHTKPPIRRNLFGSVDHDEFRRECLVQMKEMEKAS
IDKWNYDFLNDKPLSQGDYKWEPMKSSDLPDFYSRPPHKRVWSSGNVDHNGNHDYRVRPS
CPTNGAELSEETEKSERQTHCHHSHNRARKRPVNPEPQSTGKKSHSSEEDEVVSKSVEQT
PSKNDSRTHEH
NT seq 576 nt   +upstreamnt  +downstreamnt
atgtgcaacaacatgtcaaatgttagtctttcgaatgggagtccgacgttggaaagggtg
gatccgcgtccgacggatcacacgaagcccccgattcgcagaaatcttttcggatcggta
gatcacgacgaatttaggagggagtgtttggttcaaatgaaagagatggagaaggcttct
attgacaaatggaattatgatttcctgaacgacaagcccctttcccagggagattataaa
tgggaacccatgaaaagcagtgacctgcctgacttttacagcagaccgcctcacaagcga
gtctggtcctctggaaatgtggaccataacgggaatcatgattaccgagtccgaccgagc
tgtcctacgaacggggctgagctatccgaggagactgagaagagcgagaggcagacgcat
tgtcaccactctcacaaccgggcaaggaaaagacctgtaaatccagaaccccaaagtact
ggtaaaaagtcacattccagtgaagaggatgaagttgtgtcaaagtcagtagagcagaca
cccagcaaaaacgattccaggacacatgaacactaa

DBGET integrated database retrieval system