KEGG   Salmo salar (Atlantic salmon): 106561376
Entry
106561376         CDS       T04363                                 

Definition
(RefSeq) uncharacterized LOC106561376
  KO
K04726  BH3 interacting domain death agonist
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106561376
   04217 Necroptosis
    106561376
   04115 p53 signaling pathway
    106561376
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106561376
SSDB
Motif
Pfam: BID PSD2
Other DBs
NCBI-GeneID: 106561376
NCBI-ProteinID: XP_013980730
UniProt: A0A1S3KQ61
LinkDB
Position
ssa10
AA seq 197 aa
MDCGNVQCTPLVFLTFLQQQSCSSAELRIQLDSLAQELKRTQDINGNGLGLNIHEEGELQ
TDGHFCSSSRILLEGLEPQAALAWPDNPADEEALRGVAAGLIEIADQLERSVMAQAAENL
TKKLQKYSIGRWKHHLALEVEWVKKQGLGPVLDYLPQEKVIMALTLTLVKGVCERAPLLL
RNLFSAAVQFINPTVAR
NT seq 594 nt   +upstreamnt  +downstreamnt
atggactgtgggaatgttcagtgcactcccctggtctttctgactttccttcagcagcag
agctgcagcagcgcggagctccggatacagctggactctttggcccaggagctgaagcga
acccaggacataaacggcaatggtctgggtcttaacatccacgaggagggcgagcttcag
acagatggacacttctgcagcagcagtaggatcttactggaggggcttgagcctcaggct
gcgctggcatggcccgataaccctgccgatgaagaagccctgagaggtgtcgctgcaggg
ctgattgaaatagctgatcagcttgagcgtagtgtgatggcccaggctgctgagaatcta
accaagaaactgcagaagtattccattgggcggtggaagcaccacctagccctggaagtg
gagtgggtgaagaagcagggcctgggccccgtgctggactatctaccccaggagaaggtg
atcatggccctcacactgaccctggtgaagggggtgtgtgagcgcgcccctctgctgctc
cgtaatctgttcagcgcagcagttcagttcataaaccctacagtggccaggtga

DBGET integrated database retrieval system