KEGG   Salmo salar (Atlantic salmon): 106561562
Entry
106561562         CDS       T04363                                 

Definition
(RefSeq) kit ligand-like
  KO
K05461  KIT ligand
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106561562
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    106561562
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    106561562
Cytokines and growth factors [BR:sasa04052]
 Growth factors
  Growth factors (RTK binding)
   106561562
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 106561562
NCBI-ProteinID: XP_013981138
UniProt: A0A1S3KR11
LinkDB
Position
ssa10
AA seq 274 aa
MKKPKIWIRVCVHLLLCITLGVQSSEFGNTVTDDITSISLLKQNIPKDYKIPVTYVPKEV
GGMCWVALNVFHLELSLRGLADKFGSISSNKYNISILIEMLKETRYHMKNLEAITYDFEC
HYRNEQWQTGHYFHFVEDFLKTARLNRDFPEECDPPPCPTATMATTITTQYPTSVNYPAI
GTEFNMSAPDSETWNEPLRFLPEVVERSLLSLLVIPIAAVVFLFAWKVKSRRNQHQSDER
NSVEGGLFTGPEGTLAPPLEEPSEKNRLNIIETV
NT seq 825 nt   +upstreamnt  +downstreamnt
atgaagaagccaaaaatttggatacgcgtctgtgtccatttattgctgtgcatcacactt
ggagtccagtcaagtgaatttggaaatactgtaacagatgacatcacaagcatttcacta
ttgaaacaaaatatacctaaagattacaagattcctgtgacatacgttccaaaagaagtg
ggtggaatgtgttgggtagcgctaaacgttttccacttggaactcagtttacgaggatta
gcagacaagtttggaagcatttcgtccaacaaatataatatcagcatattgatcgaaatg
ctgaaagagacaagatatcacatgaagaacttggaggcgattacgtatgattttgagtgc
cactacagaaatgagcaatggcagacaggacactattttcattttgtcgaagatttttta
aaaacggcccgtttgaatagagattttccagaagaatgtgatccacctccctgtcccaca
gcaacaatggctacaacaataacaacacaataccccacatcagtcaactatcctgccata
ggaacagaattcaacatgtcagcaccagactccgaaacctggaatgagcctctgagattc
ctgccagaagtagtggagagaagcctcctgtcactacttgtcattcctattgcagccgtt
gtgtttctgtttgcgtggaaggtgaaatcaaggaggaatcaacatcagtcagatgaacgg
aactcagtggaaggaggccttttcacaggaccagaagggactttggcacctccactagag
gaaccatctgaaaagaacagattgaacatcatagagacagtgtaa

DBGET integrated database retrieval system