KEGG   Salmo salar (Atlantic salmon): 106561617
Entry
106561617         CDS       T04363                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K04503  G1/S-specific cyclin-D1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04310  Wnt signaling pathway
sasa04340  Hedgehog signaling pathway
sasa04371  Apelin signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106561617
   04340 Hedgehog signaling pathway
    106561617
   04371 Apelin signaling pathway
    106561617
   04068 FoxO signaling pathway
    106561617
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106561617
   04115 p53 signaling pathway
    106561617
   04218 Cellular senescence
    106561617
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106561617
   04530 Tight junction
    106561617
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 106561617
NCBI-ProteinID: XP_013981218
UniProt: A0A1S3KR94
LinkDB
Position
ssa10
AA seq 291 aa
MEHQLLCCEVETIRRAYQDSNLLNDRVLQTMLKAEDSYLPATNYFKCVQKEIVPCMRRIV
STWMLEVCEEQKCEEEVFPLAMNFLDRYLSVEPTKKTRLQLLGATCMFLASKMKETIPLT
AEKLCIYTDNSIRPIDLLQMELLVLNKLKWDLASVTPHDFIDHFLSKLPIHQDTQQILRK
HAQTFVALCATDVKFIANPPSMIAAGSVAAAVQGLHLKMDDAMSSQQLTYFLSQVIRSDP
DCLRACQEQIESLLETSLRQAQQHTVSTDTKSMDEEVDLSCTPTDVRDVNI
NT seq 876 nt   +upstreamnt  +downstreamnt
atggaacatcagttgctgtgctgtgaagtggagaccatccggagagcttaccaagactcg
aacctgctcaacgatagagttttgcagaccatgctaaaagctgaagacagttatctccca
gcaacgaactacttcaaatgtgtacagaaagagattgtaccttgcatgaggagaattgtt
tctacatggatgctagaggtgtgtgaggaacagaaatgcgaagaggaggtttttcccctc
gctatgaattttttggacagatatttgtctgttgaaccgacaaagaagacccgactacaa
ttattgggagctacctgcatgtttctggcgtctaaaatgaaggagaccattcctctaacc
gcagagaagttgtgcatatacactgacaattccatccgaccaatcgatttgctgcaaatg
gaactactagtattgaacaaactgaaatgggatctagcctcagtgactccgcacgatttc
atagaccatttcctctccaaactacccatccatcaggacacccagcaaatcctgcgcaag
catgcccagacctttgtggccctctgtgctacagatgtcaaattcattgccaaccctccg
tcaatgatcgcagcgggcagtgtggcggctgctgtgcaggggttgcatctgaagatggac
gatgcaatgtcatcccagcaactgacttacttcctgtcccaagtcatcagaagtgacccg
gactgtctacgggcgtgtcaggaacagatcgagtccttattggagaccagtctccgtcag
gcacagcaacacactgtttccacggacaccaagagcatggatgaggaggtggacctctcg
tgcacgccaacggacgtgagagatgtgaacatctga

DBGET integrated database retrieval system