KEGG   Salmo salar (Atlantic salmon): 106561946
Entry
106561946         CDS       T04363                                 

Definition
(RefSeq) growth arrest-specific protein 1-like
  KO
K06232  growth arrest-specific 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106561946
SSDB
Motif
Pfam: GDNF DUF1380
Other DBs
NCBI-GeneID: 106561946
NCBI-ProteinID: XP_013981884
UniProt: A0A1S3KU95
LinkDB
Position
ssa01
AA seq 265 aa
MASFAGFIKWTGRSTLYLCCAFVLFGCLCIASPTHGRRLICWQAIMKCHGESECHYAYDQ
YLYACAPVINGDRKKCPSHCISSLIQLNLTETGPSLEDCDCASDPVCRSTKRAIEPCLPR
TSNMGCTEARRQCERDSQCSSAMRDYLFHCRKLFGGERCSDDCRRVIANMRNIPKAQQLD
TCVCDGTERTICEYVKVSMKNFCFDSMDRYAGSGFSDSEDDSEDDYDEMEDYIYVENKSF
SSRSACQGVVWTASVATILVLMNLI
NT seq 798 nt   +upstreamnt  +downstreamnt
atggcaagttttgccgggtttataaagtggactgggagatcaactttgtatttatgctgc
gcgtttgtcctgttcggctgtctctgcatcgcgtcccctactcatggtcgtcggctcatc
tgttggcaagccatcatgaagtgtcatggagagtctgagtgccactacgcatatgaccaa
tacctttacgcctgtgcgcctgttatcaacggggataggaagaagtgtcccagccactgc
atctcgtcccttatccagctgaatctaaccgagaccggcccgtctctggaggactgtgac
tgcgcctcggaccccgtctgccggagcaccaaacgcgccatagagccgtgcctgcctcgg
acaagcaatatgggctgcaccgaagcccggcggcaatgcgagagagactcccaatgcagt
tcggcaatgcgcgactatttgtttcactgccgtaaacttttcggaggggagagatgttcg
gacgactgcaggagggtgattgccaacatgcgaaatatacccaaagcacaacaacttgat
acttgtgtttgtgatggcacagagaggaccatatgcgagtacgtcaaagttagtatgaaa
aacttttgctttgactctatggacagatacgcgggcagcgggttttctgattcagaggac
gactctgaagatgattatgacgagatggaggattatatatatgtggaaaacaaaagtttt
tcatccagatccgcctgtcagggtgttgtatggactgcctctgtggccaccattttggtt
ctaatgaatctgatctga

KEGG   Salmo salar (Atlantic salmon): 106568361
Entry
106568361         CDS       T04363                                 

Definition
(RefSeq) growth arrest-specific protein 1-like
  KO
K06232  growth arrest-specific 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106568361
SSDB
Motif
Pfam: GDNF DUF1380
Other DBs
NCBI-GeneID: 106568361
NCBI-ProteinID: XP_013994121
UniProt: A0A1S3LTC6
LinkDB
Position
ssa13
AA seq 262 aa
MASSAGFIKWTGRSTLYLCCAFALFGCLCIASPTHGRRLICWQAIMKCHGEPECHYAYDQ
YLYACAPVINGDRKKCPSHCISSLIQLNLTETGPSLEDCDCASDPVCRSTKRAIEPCLPR
TSNMGCTEARRQCERDYQCSSAMRDYLFHCRKLFGGERCSDDCRRVIANMRNIPKAQQLD
TCVCDGTERTICEYVKVSMKNFCFDSMDRYAGSGFSDSDSEDDYDDMEDYVYVENASGSP
RSACRGVWTSTVATILVLMHLI
NT seq 789 nt   +upstreamnt  +downstreamnt
atggcaagttctgccgggtttataaagtggactgggagatcaactttgtatttatgctgt
gcgtttgccctgttcggctgtctttgcatcgcgtcccctactcatggtcgtcggctcatc
tgttggcaagccattatgaagtgtcatggagagccggagtgccactacgcatatgaccaa
tatctttacgcctgtgcgcccgttatcaacggggataggaagaagtgtcccagccactgc
atctcgtcccttatccagctgaatctaactgagaccggtccgtctctagaggactgtgac
tgcgcctcggaccccgtctgtcggagcaccaaacgcgccatagagccatgcctgcctcgg
accagcaacatgggctgcaccgaagcccggcggcagtgcgagagagattaccaatgtagc
tcggcaatgcgtgactatttgtttcactgccgtaaacttttcggaggcgagagatgttcg
gacgattgcaggagggtgatagccaacatgcgcaatatacccaaagcacaacaacttgat
acttgtgtttgtgatggcacggagaggacgatatgcgagtacgtcaaagttagtatgaaa
aacttttgctttgactcaatggacagatacgcaggcagcgggttttctgattcggactct
gaagatgattatgatgatatggaggattatgtctatgtggaaaacgctagtggttcacct
agatccgcctgtcggggtgtatggacttccactgtggccaccattttggttctaatgcat
cttatctga

KEGG   Salmo salar (Atlantic salmon): 106570975
Entry
106570975         CDS       T04363                                 

Definition
(RefSeq) growth arrest-specific protein 1-like
  KO
K06232  growth arrest-specific 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106570975
SSDB
Motif
Pfam: GDNF
Other DBs
NCBI-GeneID: 106570975
NCBI-ProteinID: XP_013999063
UniProt: A0A1S3M714
LinkDB
Position
ssa15
AA seq 266 aa
MASFEALAHGSCRLVWPVGCVFLFLGCLSVASSSHSRRLICWQAIMNCQTEPECHYAYGQ
YMQACAAVLRGDRKRCPSHCISSLVQLNLTKNGPALEDCSCASDPICRNTKRAIEPCLPR
TSNMGCTEARMQCERDQQCSSAMRDYLIYCGKLFSGATCTNACRNVIADMRKIPKAELLD
SCVCDGTERTICEYVKISMKSLCFEAPVTVEDGSGSEDYEEDDGDFPVSEPELVERSTGS
GGSASGSCGVVTAVTLSVLILLAFLL
NT seq 801 nt   +upstreamnt  +downstreamnt
atggccagttttgaggctttggcacacggctcctgcaggttggtgtggcctgtcggttgt
gtgtttttgtttttgggctgcttatcggtggcatcgtcttcccacagccgcaggttaatc
tgctggcaggccatcatgaactgtcagacggagcctgagtgccattacgcatatgggcag
tacatgcaggcgtgcgctgctgtactgagaggggacaggaagaggtgtcccagtcactgc
atctcctctctggtgcagctcaacctgacgaagaacgggcccgcgcttgaggactgcagc
tgtgcttcggaccccatctgccggaacaccaagcgggccatcgagccatgcctccccagg
actagcaatatgggctgcaccgaggcccgtatgcagtgtgagagagaccagcagtgcagt
tccgccatgcgagactatttaatctactgcgggaaacttttcagcggggcaacctgcacg
aatgcttgtcggaatgtgattgcagacatgcgcaaaatacccaaagcggagctgttggat
tcgtgcgtgtgcgacgggaccgagaggaccatctgcgagtatgtcaagattagcatgaag
agcctgtgcttcgaagctcctgtgacggtggaggacggcagtgggtcagaagactacgag
gaagatgatggggacttcccggtgtcagaaccggagttagtggagaggagcaccggatca
ggtggttctgcttcgggaagctgtggtgttgtgaccgcagtgactttatctgttctgatt
ctactagcatttctcctttaa

KEGG   Salmo salar (Atlantic salmon): 106579098
Entry
106579098         CDS       T04363                                 

Definition
(RefSeq) low-density lipoprotein receptor-related protein 2-like
  KO
K06233  low density lipoprotein-related protein 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106579098
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106579098
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    106579098
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF DUF5050 SGL EGF_CA
Other DBs
NCBI-GeneID: 106579098
NCBI-ProteinID: XP_014014128
UniProt: A0A1S3NF92
LinkDB
Position
ssa19
AA seq 4616 aa
MDLLGLNVLSLLLLSQGIQLTQGQCDSGKFQCDNGQCIDLDWRCDGTKDCTDDSDELNCP
PPSCSSQQFKCVTGGECISLQFVCDGEEDCTDGSDEQRTCREQTCGPYQFTCQEGQCIPK
VYRCDRVKDCLDNSDENNCNYPSCTEKTCANGACYNNSQHCNGLQNCRDGSDESNCTTQQ
CPLHQFQCTNGYCIPMSFICDHWDDCGDNSDEQGCEYQSCSGTQFTCPSGRCIPQSWVCD
EFNDCGDYSDENGCDSNSRDCYPGEWPCPGSSMCVPVGKVCDGKPDCPRGTDETNTTAQQ
TCSLDQCSALSCEYLCHFTPQGGACYCPDGFIVANDSRSCVDYDDCDIWGICDQLCEDRP
GTHRCSCADGYFLEQGNRCRANISVGLPQLIFTNGGEVMMADIHGRFIRTLVPSQGRGSS
VGVGYHWHSQRVFWTDTNTQKVYSANFDGGDIQEVLNEAVHSAQNIAVDWINFKLYVLEA
RVERIDMCDFDGGNRATLVAENLLTPHGLALDPTVGYMFFTDSGYISEDMKLERAYMDGS
NRVELVKTRLGMPTGVTLDIVTQRVYWSDSHFNMVETVTYSGLERKTVLNGGTQVPYPFG
ISVFENHLFFTDWTKMGVIRTNRFNGSDPNLIYSTADRPGHIVVAHPALQPIVMSPCGRN
NGGCQHICVLSHLSDNDGLGFRCKCRLGYDLHEDRHSCFKVRDYLLLATQYAVRGIPLNV
SLQEDVTLPLTGLGVTFSSSAVEFDGNEEAVFYNDRSRQIIYKSNTNGSNTEILTGYRVG
HAESMAYDWTSKVLFWTSSSYRVVVAFRVTDKSRRDIVTGLKSPRGLAVHPSAGYLFWTD
WYRPAVIMRSWTDGSNAVPLINTTLGWPNGLTIDYVNDRLYWADALLDQVGHVGIDGYDR
QMFSNIGQITQPFSITIHADYLFVSDSRTRSVFRMRKRDGGEITPIRKGISGILSVKAYT
ADLHGMFNSRCNMVPNGRCSHFCFPVPSSSRVCGCPYGMKLQENQRDCVKDDSVPPIDTS
CGDYSFPCDGGRCMPNSYRCDGVKDCMDQTDEANCTDTGMTCSPWAFTCDNKHCILSSWR
CDGHEDCGDGSDEVNCPTRLPFTCSSEQFACTDGSRCIPKAWTCDADKDCSDGSDERNCN
GTIATCEPGYFFCPDHRCIYSSYVCDGDQDCMDGSDEKDCEFSCSSYEFACASGDQCVSS
IYRCDGVFDCRDQSDESGCPTRGPGLCHNDEFQCQTDGLCVPDEWECDGHHDCEDGSDEH
NSCPPVTCHINYFQCANGNCISPSWVCDGDNDCRDMSDEQNCPTPPFMCPSGQWLCPTGQ
VCIVLGKVCDGQRDCPNGADESPLCNQEDCALNNGGCSDGCIQGPFGAECTCQPGYQLLN
DSKTCDDIDECSIPGWCSQQCYNERGSFRCSCSDGYILEADSRSCKATDPTAATLLVAKR
SQIISNKVNLRPPLIHPVVSGSDIVTVDFDRLTGRIYWADASLKKIFTSFQNGTDRREVF
STGLMVPESIAVDWVARNLYWTDSVMENIEVSTLDGRFRKVLLTKNVTSPRGLALDPRNH
TNVMFWSDWGQNPRIEMAYMDGTGRQAIVTTKLYWPNGLALDYTTRRVYFADAYLKYIDY
CDYNGNNRFQVMASDMVLQHPHGMTIFEDHIYWSERYTYQVLRTNKFHGGNTTTMITNVY
QPLGIVMDHPIKQPAAINPCAEHLCSQLCLLSGFRPRYYTCHCQSGWNLNSDGRTCIKDD
TPFLMVVKETVIFGIPVDPADPSNNAMAPVSGITQGRDIDFDDQEQFVYWVQDSSSIYRV
KTDGTNRTLFAPSAIIGSPSGLAFDWITRTMYYTNPTNKAIEVIRVDGVQLYRKTLITNT
GKLEGAGEPIGIALDPARGKLFWTDRGTDSGVPPKVASADMDGGNLRNLYTINQGIIGFI
TADIAMSKLYWGVASTGVIECGTMDGVSRVTIVSQLSHPWGLTVHQHYLYYTDLDYEVIE
RVDKGTGANMVVLRSGMTGVRALKVHARDNSAGTTNGCSTNNGACPHLCLPKPGGQKTCV
CTTGLVPSKDGTTCVQYDSYAVVSTPRLIRGFHINSSDHSEAMVPVAGYSYSVMDKLDLH
VASRYIYWIDNSTSSSYRGIFRAQTDGGSFTPVVNQGIGRGGIKGMAVDWISGNLYFTNA
IEAQTYLEVTRLETPYRTVLLKSTEDRPSDLAVSPKLRFLFWADGGQNPKIERAQLDGAN
RTVLASESLASPRGLTVDYTNDFLYWTDDVLDMISRMAPDGTQREIVRYGSRYPAPYGLS
IFGNSMLWVDRKLGKLFQASKDPANTTQPEVIRDGIDGLTDVVVFNSHVQPTAANLVGFN
PCQEDNGRCQQLCFALPEQEQPTCACAHGSLLNNGVSCGYGLYEFLVFTTDYTMNSLRLD
PSDHTSPYPTINLGYNVVALDFDFADKRIFFAQYMGIGRSRIGYVITTVTGAPAIIADNL
NYPQGLAYDWVHKRLYFTDNYNRSVQAMGVDGQNRSLIAHANRPLGIIVDPCYGYLYWTD
WGSPAKIERATLGGNFRVPIISTSLSQPKGLSIDNEERMLYWADASLDKIERSTLTGESR
QVIMRGVQYPYAMTVFQQDIYWTDWTTRAVYRAGKDDGSGFTVLVQELQYRPNDIHVFAG
SKQEACSSPCQQFNGGCSHVCVPGPSGPECQCPVSGNWYLANNGRDCIHDNGNRCQPEQF
TCLNGGCISVRLKCDGYSDCQDNSDELERVCAFHKCSAQDFTCDNGRCVALSYVCDYTND
CGDNSDELGCPFPTCASATEFTCTNGRCISAAFVCDGYNDCRDNDTSDEINCPPRTCPSG
QTKCDTTNICIYASQLCDGYNNCGDNSDENPLFCAGRTCSPDQFRCDEGKCIPSYWVCDW
VRDCVDGTDEPPSCQDQINTCHPDQFTCTNGNCIPMSMTCDGNNDCWDNSDEALELQCGE
RTCASHQFTCPPPWRPGHPRCIPLSYVCDGEKDCADAADELQNCPNRTCHMNEFTCANGL
CILIPFRCDRVNDCGDGSDELGCSYDTCTSYQFTCQNGACIPATFTCDGEADCLDLSDEA
EGMCSTPQPTCAPGEYLCKSGECIDTHKVCNSQKDCSDNSDEKGCGINECQDPSVHKCAQ
VCTDTLTGYYCSCNAGYHLMPDGKACADLDECRDTPAVCSQICENSAGSFHCKCAPGYVR
EPDGRTCRQNSAIAPYLLYSNRYYIRNLTTDGSQLSVVLQGLSNVVALDFDHYEKRLYWL
DAGMVRIERMRFDGSERETIVDNNVVGAEGLAVDWVGRKLYWVDGYYGSLHVSELDGRFQ
KKLLSGCMGPNATYCFVRPRAVAVNPKYGWLYWTDWGDTAYIGRVGMDGTKATALITTKL
EWPSALTIDYTTNKIFFTDSHLNFLDFADMDGENRHRAIAGSLPHPFAVTLFEDWVYWTD
WNTHTVEKAHKYTGTGRVVMGNNTHRPNDIHVYHPYRQPRSDNPCATHHLTCSHLCLIGP
GGTSATCECPDHFIGISVGFKIQCVADCSSTQFRCGDNEKCVSIWWKCDGQSDCGDGSDE
PLTCPPRYCPIGQFQCQDGNCTYPGFLCDGHADCRDNSDEDAALCSDHRCAENQFQCKNK
QCIPVSWHCDGIVDCSDGSDEDTDGCAQKTCRPGQFTCANGVCIPPNYVCDAQNDCGDGS
DEPHEICMGPEYNCDELTEFSCKTNYRCIPTWAVCDGSNDCLDNSDEQNCEALTCDPLGD
FRCDNHRCVPIRWKCDGSNDCGDGSDERDCVPRPCSESEYRCDNQQCIPGNWVCDHGNDC
GDNSDERDCELKTCRPGYFQCLSGHCIPAALQCDGRPDCLDISDESSCPTRYPGGRWCPN
HQFQCANKLCVYENWVCDGNNDCGDQSDEELILCLNITCEMPSRFRCANGYCIYSGNLCN
QKDDCGDGSDEKEDLCREPTLAPCTLQEFKCTNGQCVALPYVCDHNDNCGDLTDEIGCNF
GHDRTCEERLCQHECTNLNRTGFICSCRPGYRVDPDSTFNCTDINECEVHGTCPQVCKNT
KGGYDCECAPGYRKVGNGNQCEAEGAGPLLLLPENIRIRKFNLQMEAYHDFLEEQEHIMA
LDYDWDHNNTGLSMVYFTVEGKDNAAGAIKRAYIPTVDDNSNNIAAAVDLGIKYITTPDG
IAVDWVGRNLYWADSRVKRIEVAMLDGRYRKHLVKTDIDHPSAVAVNPRLGMLYWADRGT
AARIEYSWLDGQHRNVLVPDGLGFPTGLSIDYANGDRVYWSDAKESRIESVLPSGEDRRT
ALYIDVRYPFSVSVFEDHIYWSTQEKGEVFRQDKFGRGTKTKLLTAGPWLTQISVYQQQR
YNSIGMKTPCKGICSHLCLLRPGGYTCACPEGTSFVSGSKTDCDAGFDPPPTMPPPCQCI
NGGTCYFDDNKAMCICPPEWQGDFCEINIFGVVASSVGIAIGVTVLIVLVLGGLVYAAQR
KASVMETISHIMPSMASFRGAPYQSSDPSKEEGSDPGPSSKAEPCTAVPMEEAGGKSFEN
PAYAAEGFERPATNAITTAILVPNGTAMENIENPLYAEVRVVAEPDPEPDASATPANTES
VEGAFENPDEELTPEEPVADESLKFEPIPDDNADDNFINPMFSDPTYPSTPADSFT
NT seq 13851 nt   +upstreamnt  +downstreamnt
atggacctcttaggtctaaatgttctgtctctcttactgctctctcaaggaattcagctt
actcaaggccaatgtgacagtggtaagtttcagtgtgacaacggtcagtgcattgactta
gactggaggtgcgatggaaccaaggactgcacagatgactctgatgagctcaattgtcca
cctccatcctgtagctcccagcagttcaagtgtgtgacgggaggcgagtgtatctccctc
cagtttgtctgcgatggggaggaggactgcactgacggctcagacgaacagagaacctgc
agagagcagacttgtggaccataccagttcacgtgccaggagggtcagtgtattcccaaa
gtgtaccgatgtgaccgtgtgaaggattgcctggacaactctgatgagaacaactgcaac
taccccagctgcactgagaaaacctgtgccaatggagcttgctacaataactcgcagcac
tgcaacggtctgcagaactgtcgggacggctcagacgaatccaactgcacaacacagcaa
tgtcctctgcaccagttccagtgcaccaatggctactgtatccccatgtcctttatctgt
gaccactgggacgactgcggggacaacagcgatgagcaaggctgtgagtaccagagctgt
agtggaactcagttcacctgccccagtggccgctgcatccctcagagctgggtgtgtgat
gagttcaacgactgtggggactacagcgacgagaacggatgtgatagtaactcccgagac
tgttaccctggtgagtggccttgtccaggctcctccatgtgtgtgccagtgggcaaggtg
tgtgatggcaaaccagactgccccagaggaacagatgagaccaacaccaccgcacagcaa
acctgcagcctggaccagtgctcagcgctgagctgtgagtacctgtgtcacttcacccca
cagggcggagcctgctactgcccagatggcttcatcgtggccaatgacagccgctcctgt
gtggactatgatgactgtgacatctgggggatctgtgaccagctgtgtgaggaccgcccc
gggacccaccgctgcagctgtgcagatggatacttcctggaacagggcaaccgctgcagg
gccaacatctcagttggcttgccgcagctcatcttcaccaatggcggtgaggtgatgatg
gcagacattcatgggcgctttatcagaaccctggtcccttcacagggcagaggtagctcg
gtgggtgtggggtaccactggcacagtcagagggtcttctggacagacactaacactcag
aaggtgtactctgccaactttgatggaggtgacatccaagaagtgctgaacgaggccgtt
cacagtgcccagaacatcgctgtggactggatcaacttcaagctctacgtcctagaggcc
agggtggagcgcatcgacatgtgtgactttgacggaggcaaccgggccacccttgtggct
gagaaccttttgactccccacgggctggctctggaccccacagtggggtacatgttcttc
acggacagcggctacatcagtgaggacatgaagctggagagggcttacatggatggtagt
aaccgtgtggagctggtgaagaccaggctggggatgccgactggcgtcaccctggatatt
gtcacccaaagggtctattggtccgacagccactttaacatggtggaaacggtcacctac
agtggtctggagaggaaaacggtgctcaacggtggcacccaggttccatacccatttggc
atctctgtttttgaaaaccatttgttcttcaccgactggaccaagatgggggtaatacgg
accaaccgcttcaacggtagtgacccgaacctcatctacagcaccgcagacagacccggt
cacattgtggtcgcgcaccctgccctgcaacccattgtgatgagtccatgcggtcgaaac
aacgggggctgtcagcacatctgcgtcctgagtcacctctccgacaatgatggcctgggc
ttccgctgcaagtgtcgcctgggttatgacctccatgaagaccgccacagctgcttcaag
gtgagagactacctcctactggccacccaatacgcagtgcgtgggatccccctgaacgtg
tccctccaggaggatgtgaccctgccgctgaccggcctgggggtcaccttctcctcatca
gctgtagagttcgacggcaacgaggaggctgtgttctacaatgaccgcagcaggcagatc
atctacaagtccaacaccaacggctccaacacagagatcctgacaggctacagggtgggc
catgcggagtccatggcgtacgactggacctccaaggtcctcttctggacatccagctcc
tacagggtggtggtggccttcagagtgaccgacaagtccaggcgggacatcgtgacaggc
ctgaagagccccaggggtctcgctgtgcaccccagtgccggatatctattctggactgac
tggtaccggccagcagtgatcatgaggtcctggactgacggcagcaacgctgttcccctc
atcaacaccacactgggctggcccaacggactcactattgactacgtgaatgacaggctg
tattgggcggatgccctcctagaccaggtaggccacgtgggcatcgacgggtacgacaga
cagatgttctccaacatcgggcagatcacccaacccttctccatcactatccatgcagat
tacctgtttgtgtcagactcgaggaccaggtcggtgttccggatgcggaagagggacggg
ggtgaaattacccctatccgaaagggaatctccggaatcctgagtgtcaaggcttacaca
gctgaccttcatggcatgttcaacagccggtgcaacatggtaccaaatggccgctgcagc
cacttctgcttccccgtgccctcctctagccgcgtgtgtggctgcccctatggcatgaag
ctccaggagaaccagagggactgcgtgaaggatgactcagtcccccctatagacaccagc
tgtggagactactccttcccctgcgacgggggccgctgcatgcccaactcgtaccgctgc
gacggggttaaagactgcatggaccagacggatgaggccaactgcactgacacaggcatg
acctgctccccgtgggcgttcacctgcgacaacaagcactgcatcctgtccagctggcgc
tgtgacggccacgaagactgtggcgatggctcagacgaggtcaactgccccacacgtctg
cccttcacctgcagttcagaacagttcgcctgcactgacggcagcagatgcatccccaaa
gcctggacgtgtgatgccgacaaggactgcagcgatggctcggatgagagaaactgcaac
gggaccatcgctacgtgtgagcctgggtacttcttctgtcccgaccaccgctgcatctac
agttcctacgtgtgtgacggagaccaggactgtatggatggctccgatgagaaggactgt
gagttctcttgttcatcctatgagtttgcctgtgccagtggtgaccaatgtgtcagtagc
atctaccgctgcgacggggtcttcgactgtagggaccaatcggatgagagcggctgtccc
acgcgaggacctggcctctgccacaatgatgagttccagtgccagacggacggcctgtgc
gtgcccgacgagtgggagtgtgacgggcaccacgactgcgaggacggctctgacgaacac
aactcgtgcccgcctgtaacatgccacatcaactatttccagtgcgccaacggcaactgc
atctctccgagctgggtgtgcgacggcgacaacgactgcagggacatgagcgatgagcag
aactgccccacgcctcctttcatgtgcccctcaggccagtggctgtgccccaccggccag
gtgtgcatcgtcctagggaaggtgtgcgacggacagcgggactgtcccaatggagctgat
gagtcacccctctgcaaccaggaggactgtgcattgaacaacgggggctgcagtgacggc
tgtatccagggtcctttcggagcagagtgtacctgtcaaccaggctaccagctcctcaac
gactccaagacctgcgacgacatcgacgagtgttccatcccaggctggtgtagccagcag
tgctacaacgagagaggctccttccgctgctcctgctcagacggctacatactagaggcc
gatagtcgctcctgcaaagccaccgaccccacagcagccacgctcctagttgccaagcgc
agtcagatcatctccaacaaagtcaacctccgaccgcccctcatccaccctgtggtcagc
ggttccgacatcgtgaccgttgactttgaccgcttgaccggcagaatctactgggccgac
gcctcgctgaagaagatctttacctcctttcagaacggcacggacagacgagaggtgttc
tccactggtctaatggtaccggagagcatagctgtggactgggtggcgaggaacctttac
tggaccgactcggtgatggagaacatcgaggtgtccactctggacggccgcttcaggaag
gttctcctcaccaagaacgtcaccagcccccgtggactggctctggacccccgaaaccac
accaacgtaatgttctggtcagactggggtcagaacccgaggatagagatggcctacatg
gacggcaccgggagacaggccattgtcaccaccaagctctactggcccaacggtctggcc
ctggactacaccacgcgccgggtctactttgctgacgcctacctcaagtacatcgactac
tgcgattacaacggcaacaaccgcttccaggtcatggccagtgatatggttcttcaacac
ccccacggtatgaccatcttcgaggaccacatctactggtcggagcgctatacttaccag
gtcctgaggaccaacaagttccacgggggaaacacgaccaccatgatcaccaacgtctac
cagcccttgggcattgtcatggaccaccccatcaaacaaccagcagcaatcaacccatgc
gcggagcacctgtgcagtcagctgtgcctactgtctggctttaggcccaggtactacacc
tgccactgccagtctggctggaacctcaacagtgatgggcgcacctgcatcaaagatgac
actccgttcctgatggtggtgaaggagactgtgatcttcggcatccctgtggacccggcc
gacccctccaataacgccatggcacccgtgtctggcatcacccaggggcgggacattgac
tttgacgaccaggagcagtttgtctattgggtgcaggactcgagctccatttacagggtg
aaaactgatggaaccaataggactctgtttgctccatctgcaatcattggctcgccctct
ggtctggcttttgattggataactcgcacgatgtactacactaatccaactaataaagca
atagaggtcattcgtgtggatggagttcaactctacaggaagaccctcatcacaaacaca
gggaagctagagggagcaggggagcctattggaatagccctggacccagccagaggtaaa
ttgttctggacagaccgggggacagacagtggcgtacctcctaaggttgccagtgctgac
atggatggaggcaacctgaggaacctctacaccatcaaccaggggatcattgggttcatc
accgcagacatcgctatgagcaagctgtactggggcgtagccagcaccggagtgattgag
tgtggtacgatggacggggtcagcagggtgaccatagtgagccagctgtcccacccctgg
ggcctcacagtgcaccagcattatctctactacaccgacctggactacgaggtcatcgag
agggtggacaagggcaccggggccaacatggtggtgctgaggagtgggatgacaggagtc
cgagccctcaaagtccacgcccgagacaactcggccggcacaaccaacggctgcagcacc
aacaatggggcctgtccccacctgtgtttgcccaagcctgggggccagaagacatgtgtc
tgcaccacaggcttagtgccttccaaggatggcaccacctgcgtgcagtacgactcctac
gcagtggtctccacccccagacttatccgaggcttccacatcaacagctccgaccactcg
gaggccatggtgcctgttgctggatactcttactctgtgatggacaagctggatcttcac
gtcgcctctaggtacatctactggatcgacaacagcacttccagctcttacagagggatc
ttcagggcccagacagacggtggaagcttcactcccgtcgtcaaccaaggcatcggccga
ggtggcataaaagggatggctgtggactggatctcaggcaacctctacttcaccaacgct
attgaggcccagacctacttggaggtgacccgcctcgaaaccccctaccgcacggtcctc
ctcaagtccactgaggaccggcccagtgacctggccgtcagccccaagctccgttttctc
ttctgggccgacggaggccagaaccccaaaattgaacgtgcccagctagatggtgccaac
cgtaccgtgttagcctccgagagcctggcatcgccacgcggcctcactgtcgactacacc
aacgatttcctgtactggacagacgatgtgctggatatgatttcacgcatggcacccgat
gggacacagagggagattgtccgttatgggagtcgataccctgctccgtacggattgtcg
atatttgggaattctatgttgtgggtggatagaaagctcgggaagcttttccaggccagc
aaggatccagcgaatacgacccagccagaggtgatccgcgacggcattgacgggctcacg
gacgtggtggtcttcaactcccacgtgcagcccaccgctgccaacctggtgggcttcaac
ccgtgccaggaggacaatgggcgctgccagcagctctgcttcgccctgcccgagcaggag
caacccacttgcgcctgcgcccacggttcgctcctcaacaatggagtgtcgtgcggctac
ggtctatacgagttcctggtattcaccacggactacaccatgaatagtttacgtttagac
ccctccgatcacactagcccctaccctactatcaacttgggctataatgtggtggcgctg
gatttcgactttgcagacaagaggatattttttgctcagtacatggggataggccgaagc
aggataggctatgttatcaccacggttaccggtgctcctgccatcatagccgacaattta
aattatccacaggggctggcctatgactgggttcacaagcgcctttacttcaccgacaac
tacaacagaagtgtccaggccatgggggtggacgggcagaaccgctccttgatagcccat
gccaaccgccctcttggcatcattgtggatccctgctatggctacctatactggactgac
tgggggagccctgctaagatagagagagctactctgggtggaaacttccgggtgcccatc
atcagcaccagtctgtcccagcccaaaggactttccatagacaacgaggaaaggatgctc
tactgggccgacgcttccctagataagattgagcgttccaccctgaccggggagagccgc
caggtgatcatgaggggggtccagtatccctacgctatgaccgtgttccagcaggacata
tactggactgactggaccacgcgagcggtctaccgtgccgggaaggacgacgggtcaggg
ttcacggtcctggtccaggaactacagtacaggcccaacgacatccacgtgttcgccggc
tccaagcaggaggcttgctcaagcccctgtcagcagtttaacggagggtgtagtcacgtc
tgcgtgccaggtccgtctggtccagagtgtcagtgtcctgtatcgggtaactggtatttg
gccaacaatggcagggactgtatccatgacaacggtaaccgttgtcagcccgagcagttc
acctgtctgaacggtggctgtatctcagtgcgtttgaagtgtgacggctacagtgactgc
caggacaactcagacgagctggagagagtgtgtgccttccacaagtgctcggcccaggac
ttcacttgtgacaacggccgctgtgtggccctgtcctacgtttgtgactacacgaatgac
tgcggcgacaacagtgacgagctgggctgcccgttccccacttgtgcctccgccaccgag
ttcacttgcaccaatggacgctgcatctccgccgccttcgtctgcgacggctacaatgac
tgccgcgacaacgacacctcagacgagatcaactgtccgcccagaacgtgtccctccgga
caaaccaagtgtgacaccaccaacatctgtatctacgctagccaactgtgcgacggttac
aacaactgtggggacaacagtgacgagaaccctttgttctgtgcaggccggacgtgctca
ccggaccagttccgttgtgacgaggggaagtgtatccccagctactgggtgtgtgactgg
gtcagagactgtgtcgacgggaccgatgagcccccctcctgccaggaccaaataaacacc
tgtcaccctgaccagttcacatgcaccaacggcaactgtatccccatgtcaatgacgtgt
gacggcaacaacgactgttgggacaatagtgacgaggcactggaactccaatgtggagag
cggacatgcgcttctcatcagttcacctgcccccctccatggcgtcctggccacccgcgc
tgtatccccctgagctatgtgtgtgatggggagaaggactgtgccgacgcagctgatgag
cttcaaaactgccccaaccgcacctgccacatgaatgagttcacctgcgccaatggcctg
tgtatcctcatccccttccgctgtgaccgagtcaacgactgcggggacggcagcgacgag
ttgggctgttcctacgacacctgcaccagctaccagttcacctgccaaaacggcgcctgc
atcccagccacctttacctgcgatggcgaggccgactgtctggacttgtctgacgaggca
gaaggcatgtgcagcaccccccagcctacctgtgccccgggagagtacttgtgcaagtcg
ggcgagtgtattgacacccacaaggtctgcaactcgcagaaggactgctcggataacagt
gacgagaagggatgcggaattaacgaatgccaagatccatcggtccacaagtgtgcccag
gtctgcactgacaccctgacaggttactactgctcgtgtaatgccggctaccacctcatg
cctgatggtaaggcgtgcgcagacctggacgagtgccgcgacacgcccgccgtctgtagc
cagatctgcgagaactccgccggctccttccactgcaaatgcgccccgggctacgtgcgt
gagccagacgggcgtacgtgccgccagaacagcgccatcgccccttatctgctgtacagt
aatcgctattacattcgtaatttgacaactgatggttcgcagctgagcgtggttctgcaa
gggctgtcgaatgtggtggcgctggattttgaccattatgaaaagaggctgtactggttg
gatgcgggaatggtgcggattgagaggatgcgattcgacggcagtgagagggagacgata
gtggataacaacgtggtaggggccgaggggctggcggtggattgggttggcaggaagctc
tactgggtagacgggtactacggctctctccacgtgtcagagctggatggtcgtttccag
aagaagttgctgagtggctgcatggggcctaacgccacctactgctttgtccggccccgt
gccgtagccgtcaaccccaaatatggctggctgtattggacagactggggggacaccgcc
tacattggcagggttggtatggatggtaccaaagccactgccctcatcaccaccaaactg
gagtggcccagtgccctgaccattgactacaccaccaacaagatcttcttcaccgactcc
cacctcaatttcctagattttgctgatatggatggggagaaccgccaccgggccatagca
ggctccctgcctcacccctttgccgtcaccctatttgaagactgggtctactggactgac
tggaacacccacaccgttgagaaggcccacaagtacactggcaccggccgcgttgtcatg
ggcaacaacacacaccggccaaatgacatccatgtataccatccctacaggcagcctcgc
agcgataacccttgtgcaacacaccacctaacctgtagccacctgtgtctgattggtcct
ggtgggaccagcgctacgtgtgagtgtccagaccacttcattggcatctccgtgggcttc
aagatccagtgtgtggccgactgttccagcacccagttccgctgcggagacaacgagaag
tgtgtctctatctggtggaagtgtgatggtcagtccgactgtggtgatgggtccgacgaa
cccctcacctgcccgccccgctactgtccaattggtcagttccagtgccaggatgggaac
tgcacttatcctggcttcctgtgtgacggacatgctgactgccgtgacaattcagatgag
gacgctgccctctgcagtgaccacaggtgtgcagaaaatcagttccagtgtaaaaacaag
cagtgcatccctgtgtcatggcactgtgacggcatcgtcgactgttctgatgggagtgac
gaggacactgatggctgtgcccagaagacatgccggccgggccagttcacgtgcgcaaac
ggagtgtgtatcccgcccaactatgtgtgcgacgctcagaacgactgtggagatggatcc
gatgagccccacgagatctgcatggggccagaatataactgcgacgagctcacggagttc
tcctgtaagaccaactaccgctgtatccccacctgggccgtgtgcgatggctccaatgac
tgcctcgacaacagcgacgagcagaactgcgaggcgttgacctgtgaccccctgggagac
ttccgttgtgacaaccaccgctgtgtgcccatccgctggaagtgtgacggcagcaacgac
tgtggtgacggctctgatgagagggactgcgtgccaaggccgtgctcggagagcgagtat
cgctgtgacaaccagcagtgcatacctggaaactgggtgtgtgaccatggcaacgactgt
ggggacaactcagacgagcgcgactgtgagttgaagacatgtcgtccagggtatttccag
tgtctgtcgggtcactgtatccccgccgctcttcaatgtgacggacgaccagactgcttg
gacatctctgacgagagctcctgtccgacccgttacccagggggccgctggtgtcccaac
caccagttccagtgtgcgaacaagctgtgtgtgtatgagaactgggtgtgtgacggcaac
aacgactgtggagaccagtccgacgaggagctcatcttatgtttgaacatcacctgtgag
atgccatcgaggttccgctgcgctaacggctactgcatctactctgggaatctgtgtaac
cagaaggacgactgtggggatggaagtgatgagaaggaggacctctgccgtgagcccacc
ctggctccttgcacgctccaggagttcaaatgtaccaatggacagtgtgtagccctgccc
tatgtgtgtgaccacaatgacaactgtggggacctcactgacgagataggctgcaatttt
ggccatgaccggacctgtgaggagagactgtgtcagcacgagtgtaccaacctgaacagg
accggcttcatctgctcctgtagacctggatacagagtggacccggacagcaccttcaac
tgcacagatatcaacgagtgtgaggtacatgggacttgcccgcaggtctgcaagaacacc
aagggcgggtacgactgtgagtgtgcccccgggtaccgcaaagtgggtaatggcaaccag
tgtgaagctgagggtgccgggcctctcctgttgctcccagagaatatccgtatccggaag
ttcaacttgcagatggaggcctaccatgacttcctcgaggagcaggagcacatcatggct
ctggactatgactgggaccacaacaacactggactcagtatggtgtatttcacggtggag
gggaaggacaatgcggcaggcgccatcaagagagcatatatacccacagtggacgacaat
agcaacaatatagccgccgctgtcgacctgggcatcaaatacattaccacgccagatggc
atcgctgttgactgggtcggaaggaacctgtactgggcggactcgagagtcaagaggata
gaggtggccatgctggatgggcgctacaggaagcacctggtcaagacggacattgaccat
ccctctgctgtggctgtcaatcctcgactggggatgctgtactgggcggaccgcggaacc
gcggccaggattgagtactcatggttggacgggcagcaccggaatgtcctggtgcccgac
ggcctgggttttcccacaggcttgtcaatcgactacgccaacggtgaccgggtttactgg
tccgatgccaaggagagtcgcattgagtcggtgctaccttccggagaagaccgccgcact
gcactgtatattgatgtgcggtaccctttcagtgtgagtgtgtttgaggaccacatttac
tggagcacgcaggagaaaggggaagtgttccggcaggacaagtttggccgtggcaccaag
accaagctgctcaccgctgggccctggctcacccagatcagtgtgtaccagcagcagaga
tacaactcaataggcatgaaaaccccttgtaaagggatctgtagtcacttgtgtctgctc
agacctggaggctacacctgcgcctgccctgagggaacaagctttgtctctggcagcaag
acggactgtgatgcaggatttgaccccccacccaccatgccccctccatgccagtgtata
aatggcggaacatgctactttgatgacaacaaggccatgtgcatatgtcctccagaatgg
cagggagacttttgcgagataaacatatttggggtggtggcatcttcagtgggtatagcc
atcggggtgactgtactgatagtacttgtccttgggggtctggtctatgctgcccagagg
aaggccagtgtcatggagacaataagccacatcatgccaagtatggctagcttcaggggt
gccccatatcaaagctctgacccatcaaaggaggaggggagtgacccgggcccaagcagc
aaagcggagccctgtactgctgttcctatggaggaggcaggggggaagagttttgagaac
cccgcctatgcagctgaggggtttgagagacctgccactaacgctatcactactgccatc
cttgtgcccaatgggacagcaatggagaacattgagaacccgttgtatgctgaggttcgt
gtggtagctgagcctgaccctgagccagacgctagcgccacacctgctaatactgaatca
gtcgagggggcctttgagaatccagatgaggaactgactcccgaggaaccagttgccgac
gagtcactaaagttcgaacccattcctgatgacaatgccgacgacaatttcataaaccca
atgttctcggatcccacttacccatccaccccagcagactccttcacttga

KEGG   Salmo salar (Atlantic salmon): 106579445
Entry
106579445         CDS       T04363                                 

Definition
(RefSeq) brother of CDO-like
  KO
K20020  brother of CDO
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106579445
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 fn3 ig V-set C2-set_2 Pur_ac_phosph_N Ig_4 Ig_5 G6B
Other DBs
NCBI-GeneID: 106579445
NCBI-ProteinID: XP_014014828
UniProt: A0A1S3NHD4
LinkDB
Position
ssa19
AA seq 1027 aa
SPTSLPSLPLSHPSLLPDEVPVFTEEPLSVVQKLGGSVTLRCSARPPSANISWRLNGREL
VAGAGGDLGVVLEPGTLLIPALTNLTLGRYQCVASTNAGGLASVPANVTAAKLRDFEQDN
QQDIEVDEGNTAVIQCHLPESQPKAQVRYSVKQEWLETSKGNYLIMPSGNLQIANATLDD
EGPYKCAAYNPVTQEVKTSTSTDRLRIRRSTSEAARIIYPPVSRTIMVTKGQRLVLECVA
SGIPTPQVTWAKDGQDLRFHNNTRFLLSNLLIDAAGEGDSGTYMCHADNGIGSESAATVL
YDVQVFEPAQVTMELQQQEVSWGESVRFSCLARGKPTPSVVWLHNALPLASSPRHRLSAR
VLRVINVGPQDDGLYQCMAENGVGSSQAAARLVTLPTGVPSRSGKLPSILRPLSPDKVLR
EQVPVKPGATGSVLTLDCSELTGQISVAEAPVILSQPRTVKADFYDLTWKPRHDGGSAVV
EYIVKYRKIEDPPGEWTSSSISGFLHKLTLAKLQPASLYEVEMSAKNCAGLGQPAMMTFR
TGKGRRGPGGQNELPKTPPIPSPRLSPPEAPDKPTISMATETSAYVTWIPRGNRGFPIQS
FRVEFKKLKGKGGGEWEEAVTNIPPQRLSVEITGLEKGMSYKFRVLAVNVIGASPPSAPS
KAYTVVGGGRPNERPVDGPYITYNEAINETTIILKWTYTAVNNTPVYGFYIFYRPTDSDN
DSDYKKDVVEGDRYWHSITDLQPETAYDIKMQSFNEGGESEFGNVVILETKARLNQRPSP
SEASSQRPEHPGGPVPRPSDLPYLIVGVVLGALVFIIVAFIPFCLWRSWAKQKQTSDLCF
PAVVHPVSSCQYTMVPLQGLALVGHCPLDPHLPPPHAIYPPNRECTPNGKHHYPTHRLPG
QRQEDVEYDMECGTLLGQTMSNGHVPVYHYSNSEPGDGGDCCLPDDSTLQLLNTSEQPIS
TQDLTGNAHFYNGDIIRENDINLDLLPCSPSPLLSLEEKSTSTATTPESQDALPLQSETE
TSDSTDA
NT seq 3085 nt   +upstreamnt  +downstreamnt
ctcccctacctctctcccatccctccctctgtcccatccctctcttctgccagatgaagt
gcccgtgttcacagaggagcctctgtccgtggtgcagaagttaggtggtagcgtgaccct
gaggtgcagcgcccgacccccctcggccaacatcagctggcggctgaacgggcgtgagct
ggttgccggggctggcggggacctgggggtggtactggagcctggcacgctgctcatccc
agccctcaccaacctcaccctgggcaggtaccagtgtgtggccagcaccaatgcaggggg
cctggccagtgtgcccgccaacgtcaccgctgccaagctgcgagactttgagcaagacaa
ccagcaggacattgaggtggatgaggggaacacggctgtgatccagtgtcacctccctga
gagccagcccaaggcccaggtccgctacagtgtcaaacaggagtggctggagacctccaa
agggaactacctgatcatgccatcagggaacctgcagatagccaacgccactctggacga
cgaggggccctacaagtgtgctgcttacaaccctgtcacacaggaagtcaagacctccac
ctccactgaccgcctgcgcatacgccgttcgacgtcggaggcggcccgtatcatctaccc
cccagtgtctcgcaccatcatggtcactaagggacagcgtctggtcctggagtgtgtggc
cagcggcatcccgaccccgcaggtcacatgggccaaggacggtcaggacctgcgtttcca
taacaacacgcgcttcctgctcagcaacctgctgatcgatgcggcgggcgagggcgactc
agggacgtacatgtgtcacgctgacaacggcatcggatcagagagcgccgctactgtgct
gtacgacgtgcaggtgttcgagcctgcccaggtgaccatggagctccagcagcaggaggt
gtcgtggggggagagtgtgcgcttcagctgcctggccaggggtaaacccaccccctctgt
ggtttggctccacaacgccctccccctggcctcgtcaccacgccaccgcctgtctgcccg
cgtgctgcgtgtcatcaacgtgggcccgcaggacgacggcttgtaccagtgcatggctga
gaacggcgtgggcagctcgcaggccgccgccagactggtcaccttaccaaccggtgttcc
gtcacggtcagggaagctgccctccatcctgcgtccgctgagcccagacaaggtgctgcg
ggagcaggtcccagtgaagcctggggccacgggtagcgtgctgaccctggactgctctga
gctgactgggcagatctctgtggcagaggcccctgtcatcctcagccagcccaggaccgt
caaggccgacttctatgatctgacctggaaacctcgccacgatggaggctctgctgtggt
ggagtacatcgtcaagtacagaaagatagaggaccctccaggtgagtggaccagcagcag
tatctctgggtttctccacaagctgaccctggccaagctccagccagccagtctgtacga
ggtggagatgtctgctaagaactgtgctggcctgggacaaccggccatgatgactttcag
gacaggcaaaggtcgtaggggtccaggaggtcagaacgaactccctaaaactcccccaat
accatcacctcgcctctctcctcccgaggcccctgataagcccaccatctccatggcgac
cgagacatcagcgtacgtgacatggatcccccgcggtaaccgtggtttccccatccagtc
gttcagggtggagtttaagaagctgaaggggaagggaggaggggagtgggaggaggccgt
cactaacatccccccccagcgactgtctgtggagatcactggcctggagaaaggcatgtc
ctataagttccgtgtgttggcggtaaatgtgattggcgccagcccccccagtgccccctc
taaggcctacacggtggtgggtggcggcaggcccaacgaacgccctgtagacggacccta
catcacttataatgaagctatcaacgagaccaccatcatcctcaaatggacgtacactgc
cgtcaacaacacccctgtctacggtttctacatcttctaccggccgacagacagtgacaa
cgacagtgactataagaaggacgtggtggagggtgatcgctactggcactctatcactga
cctgcagcctgagacggcctacgacatcaagatgcagagcttcaacgaggggggagagag
cgagtttggtaacgtggttatcttagaaactaaagctcgtctgaaccagcggccctctcc
atcggaggcgtcgtcccagagaccagagcaccccggggggcctgtgccccgccccagcga
tctcccctacctcatagtgggtgtggtcctgggggccctcgtcttcatcattgtagcctt
catccccttctgcctgtggagatcctgggccaaacagaagcaaacatcagacctgtgttt
cccagccgtggtgcaccctgtctcctcatgccagtataccatggtgcctctgcagggcct
ggctctggttggccactgcccgctggacccccatttgcccccaccacacgcaatctaccc
ccctaacagagagtgtacgcccaatgggaaacaccattaccccacacaccgtctgccagg
acaacgccaggaggatgtggagtatgatatggagtgtggcacactgctaggacagaccat
gtcaaacggacacgtgccagtctaccactactctaacagtgaacctggagacggagggga
ctgctgtctgcccgatgactccaccctccagctcctcaacacctctgaacagccaatcag
cactcaggacctgacgggcaatgcccatttttacaatggggacatcatacgggagaatga
catcaatctagaccttctaccctgctctccctctcctctgttatcactggaggagaagtc
cacatcaacagctacaacgccagaatcccaagatgcacttccactccagagcgaaacgga
gacgtcagactcaacagatgcttga

KEGG   Salmo salar (Atlantic salmon): 106581783
Entry
106581783         CDS       T04363                                 

Gene name
lrp2
Definition
(RefSeq) LDL receptor related protein 2
  KO
K06233  low density lipoprotein-related protein 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106581783 (lrp2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106581783 (lrp2)
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    106581783 (lrp2)
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF DUF5050 SGL EGF_CA Arylesterase He_PIG hEGF
Other DBs
NCBI-GeneID: 106581783
NCBI-ProteinID: XP_014019552
UniProt: A0A1S3NVW5
LinkDB
Position
ssa21
AA seq 4703 aa
MRSWTDQPGPSIRMWRAVLAKLLVILIFCTFRCHSQGCETGQFRCGTGRCIPQHWRCDGT
LDCVDDSDEADCPLVTCDESHFQCLSDGECVPDVWVCDDEEDCEDGSDERHRCPGRMCSS
GQFSCTNGACIPGEYRCDRLPDCSDGADERDCHYPECTELRCANSACYNRTQHCDLVMDC
RDGSDEANCTQHCSSGLFQCGNGECVPQRYVCDHDDDCGDRSDEQSCTYPTCRGSYFTCP
SGRCVHQVWLCDGEDDCEDNADEKGCDAVSRECYPGEWPCPSSGLCIPMDQLCDGTAQCP
DGEDETNATAGRNCSIWRCASLSCEHRCHASPEGGTCTCPSGYTVNNNNSRSCIDFDDCQ
MWGVCDQLCEDRIGTHRCSCREGYFLEQHRYCRANTSTSVASLVFSNGQDLLIGDIHGHS
SRTLVHSQNRGVPVGVDFHYLLNRVFWTDTIQNKVFSVDMDGSNMQVILNVSVDYPENLA
VDWVNNKLYVVEASVNRIDMVDFDGNNRVTLIAENLGNPRGLAVDPTVGFLFFSDWDSLN
GEPGLERAYMDGTNRYGIIRTKLGWPAGITLDIDAKRVYWVDSRYDYIETTTYDGLHRKT
VVHGGAVIPHPFGISLFEHTVYFTDWTKMAVMKANKFSDTNPQVVYTTSQTPHGVQVVHQ
LRQPYVANPCGVDRDGCEQICILSHRSDNQGLGYRCRCRMGYDLHADGKRCVAVRQFLLF
SSQLAVRGIPFNLSSQEDVILPVTGTPSYFVGVDFSAEDDAIFFSDTAKDIIYKQKVDGT
GREVLAANRVDGVEDLAFDWISKNLYWTDPRFRSISVMKVADQSRRAIIRNLNNPRSIVV
HPVIGYIFWTDWYRPAKIMRAWCDGSHALSIVNTTLGWPNGLAIDWSSMRLYWVDAFFDK
IEHSTFDGQNRLSLERITQISHPFGLTIFGGYAYFTDWRLGGIVRVRKTDGGEMVIIRRG
ISHIMHVKTFNYNSQTGSNFCNRNTNPNGDCSHFCFPVPDSQRVCGCPYGMKLAPSQQTC
VEDPSNEPPTLQCGSNSFSCTNGKCVPQNYRCDGVDDCHDNSDEANCGGAHNTTCSPRAF
TCANQHCVPSGWHCDGHNDCFDSSDEQDCPTQTPGTCAANQFTCANNRCIPHVWLCDTDN
DCGDGSDEANCNLSGTCHPEQFQCPDHRCIGPSYVCDGDRDCTDGADEQGCIYNCTLYEF
KCSNGHQCINSYYRCDGVFDCSDHSDESGCHDREPLPATRPPGMCHHESEFQCQSDGSCI
PSTWECDGHPDCEDGSDEHHVCPLRTCPTTLFRCDNGNCVYQRWLCDGDNDCRDMSDERD
CPTPPFRCPSWQWQCPGHSMCVNISRVCDNNPDCPNGADESPLCNEPLPDQESCTDNNAG
CTHGCIQGPFGAQCTCPMGYHLSNDSKTCDDIDECSPPGLCSQHCFNERGSFRCHCSDGY
TLEADQRTCKVSGSREAFLLVASRNQIVSDDITTQPNVVRSLVRDGRNIVALDFDSVTDR
VYWSDTSQDRIWSAHKNGSDRAVVFDSGVTVTESLAVDWVGRNLYWTDYVLETIEVSKLD
GTHRTVLVSENVTNPRAIVLDPRDSAHLMFWTDWGRNPRIEKASMDGKMRTTIISNKLYW
PNGLTIDYPNNLLYFADAYLDFIDYCDYNGKNRKQVLASDLVLQHPHAITIFEDFVYWTD
RYINRVIRAHKWHGENQTVMLYNLPQPMGLVAVHPSRQPAGENHCFSSPCSHICLLSAVG
PSFYSCACPSGCTLAADQITCARVEDPFLVVVRDSVIYGIPLNPDVKSNDAMVPVAGLQN
GYDVDFDITEQTIYWVEHPGEIHRVKSDGTNRTEFAPAAILGSPVGLALDWITENLYYTN
PATQSIEVLRLRGEMQYRKTLITNNGSPTGAGTPVGIAVDPARGKLYWTDQGTESGIPAK
VAAADLDGSNPVTLFTNNLDQVEFITVDISENKLYWAVTGAGMIERGDPDGTNRITIVTG
LSHPWGVAVHESFLYFTDRDFEVIERVDKATGANKVVLRDNVSGLRVLKVHYRETSAGTS
NGCSNNMGLCEHLCLPRPGGLYTCACATGFKLSADNRTCASYQSYVVISMLSALKGFSLE
GADHSEAMVPVAGRGRNALHVDVHMASGFLYWCDFSSTVTSQNGIRRIKSDGAGFDSVVT
SGIGRNGIRGIAVDWAAGNLYFTNAFLTETYVEVLRLNTTFRRVLLKTQVDMPRHIVVDP
KNRYLFWADYGQNPKIERALLDGTNRTVLVSSGIITPRGLALDYQTGYVYWVDDSLDMIA
RVNPQGGETEVVRYGSRYPTPYGITVFETSIIWVDRNLKKVFQASKEPGSTEQPAVIRDN
INMLRDVTIYDQRIQPSSAQQLNNNPCLETNGGCAHFCFALPGNQTKKCGCAFGNLGTDN
EGCVVSRDDYLIYTTESAVQSLHLDTDDHGLPFPVVNVPGTSVALDFDRTDNRIYFTQSS
GAGSSKISFISLSSPTSPPVVVASDLGAPDGIAYDWINKRIYYSDYINQTINSMAVDGTQ
RSIIAHVPRPRAIMLDPCRGYMYWTDWGTNAKIERSTLGGNFRAEIVNSSLVWPNGLTLD
YEEQRLYWADASLQKIERCSLTGANREVIVSTAIYPFAMTMYGQYIYWTDWNTRSIYRAN
KHDGSDQRVMTQNLPSRPMDVHVLASNKQQQCNSPCQQFNGGCSHICTPGPQGAECQCPS
EGRWYLADNKHCIPDNGTRCQEGQFTCMNGRCIRAQWKCDNDNDCGDGSDELERVCGSKN
DFQTSVQVQMAAAFIALSAFHTCEPTVFTCGNGRCVPYHYRCDHYNDCGDNSDEVGCLFS
PCDPNTEFPCNNGRCISKDYICNGINNCYDNGTSDEQNCPERTCQPEHTKCTSTNICIPR
SYLCDGDNDCGDMSDESPTHCATSTCAQNEFRCSSGRCIPAHWYCDGGTDCADGSDEPSS
CTTLVRTCNTDQFPCDDGRCIASSWICDGDNDCGDMSDEDQRHNCDNRTCSVLEFTCVNN
QAPQRKCIPRDWVCDGDADCADALDEHQNCTRRSCGVNEFTCSNGLCIRSSYRCDRRNDC
GDSSDEQGCTYQPCQQHQFICQNGRCVSRDFICDGDNDCGDESDELDHLCRTPPPTCPPG
QFRCDNGHCVPLFNVCDRTDDCSDNSDEKGCGINECTNPSMHHCDHNCTDTPTSFICTCR
PGYRLMSDNKTCDDVNECAETPSVCSQVCENTVGSYMCKCAPGFLREPDGHSCRQNSNIT
PYLIFSNRYYLRNLSTDGEAYSLILQGLTSVVAMDFDRVDKRFYWIDVSRRLIERMFYNG
SNREVVVNGVLHGEGLAVDWVARKLYWLDSFLDCLKVSELDGRFVKKLAEHCVDANNTYC
FENPRALVLHPKYGYVYWTDWGDKAFIGRVGMDGTNKTTIITTKIEWPNGVTIDYSNDKL
YWSDAHLNYIEFSDLEGHHRHTVYDGILPHPFALTVFEETVYWTDWNTRTVEKGNKYDGS
GRQSLVNTTHRPFDIHVCHPYRQPIVTNPCAVNNGGCSHLCLLRDGGRGHTCECPDHFLT
LQLGGVARCLPMCTSTQYRCADNERCIPIWWKCDGQRDCRDGSDEPSTCPSRHCQLGQFQ
CNDGNCTSPHFLCNSNQDCHDGSDEDPVLCATHQCETHQWQCTNKRCVPEAWQCDGEDDC
GDGSDEEPTHCSSRTCRPGQSKCRNGRCIPQNWKCDVDDDCGDNSDEPLDECMGPSYRCD
NHTQFDCRTNYRCVPLWSVCNGHNDCRDNSDEQGCEEVTCDPLGDFRCDNHQCVPLRWRC
DGDNDCGDSSDERACSPRVCSESEFRCDNLHCIPDRWVCDHDNDCEDNSDERDCELRTCH
MGYFQCGSGHCIADRFKCDGNADCMDYTDEISCPTRYPNGTYCPPFLFECRNHVCVQPYW
KCDGDNDCGDNSDEELHLCLDIPCDTPFRFRCDNNRCIYSHELCNSVDDCGDGTDEKEEH
CQTPTHGPCSADEYKCSNGQCIPLQYTCDDYDDCGDHSDELGCNVGSGRSCSDNICEHNC
TDLTDGGFLCSCKPGYKPSQIDRNTCEDVNECEVYGTCPQECQNSKGSYECFCAQGFRSV
SEQHGMECAAEGYPPVLLLPDNVRIRCFNLSSEQYSDYVDNMEHIQALDYLWDPEGIGLS
IVYWTVLGRGSQFGSIKRAYMTTFNDNGNNPVKELDLNLRYIANPDGIAVDWIGGHIYWT
DAGTNRIEVAKLDGRYRKWLIHTDLDQPAAIVVNPALGLMYWTDWGRRPRIESAWMDGQH
RQVLLDEDLGWPTGLALDYLNGDRIYWCDSKENIIESMKPDGTERKIIMSGDIGNPYSLD
VFEGHVYWTTKERGEVWKTDKFGKGDKVKVLTINPWLTQVRIYQEHRHNRSVPNPCKNMC
SHLCLLRPGGYTCTCPQGSSLVGFNPNECDAAIEAPVLMPLACRCMNGGTCYTDEGGLPK
CKCPYGYAGSYCEMGKSRGAPAGTAVAVLLAVIIILITGALAVGVFLNYKRTGSLIPSMP
KLPSLSSLVKSGDTGNGVTFRSGDNVTMDLGPPPIGVSFIDRAMQLDENFAVEAGRQPIT
FENPLYATAAAGSSSDPAVIHATQVTVTVSGEQIEKNFANPAYHTDQIVCTVDSSTARAK
PVQESRWSFFKRKFKPSTTFENPTYSEMQNEKAVGSNEESSSTDPSPFAPTAKPFKRDRP
STYSPTEDTFRDTANLVKEDSDV
NT seq 14112 nt   +upstreamnt  +downstreamnt
atgaggagctggacggaccagccgggacccagcatcagaatgtggagagcagtacttgca
aaacttcttgttatattgattttctgtactttccgctgtcattcacaaggttgtgagacg
gggcagttccggtgtgggacaggccgatgcatcccacagcactggcgttgtgatggaacg
ttagactgtgtagacgattctgatgaagccgactgcccccttgtaacatgtgatgagagt
catttccagtgcttgagtgacggggagtgtgtcccagatgtctgggtttgtgacgacgaa
gaggactgtgaggacggctcagatgagagacaccgctgtcctggtaggatgtgctccagt
gggcagttcagctgcaccaatggggcctgcatcccaggggagtacaggtgtgaccggctg
cctgactgctccgatggggctgacgagagagactgccactaccctgagtgtacagagctg
aggtgtgccaacagtgcctgttataaccggacccagcactgtgatctggtcatggactgc
cgtgacgggtcagacgaggccaactgcacacagcactgcagcagtggcctgttccaatgc
ggaaacggagagtgtgtccctcaacgctatgtctgtgaccatgacgacgactgtggagac
cggagtgatgaacagagctgcacctatcccacttgcagagggagttacttcacgtgcccc
agcggtcgctgtgttcaccaggtctggctttgtgatggagaagacgactgtgaagacaat
gcagatgagaaaggctgtgacgctgtatcgcgtgagtgctatcctggagaatggccctgt
ccgtcctcaggcctgtgtatccccatggaccaactgtgtgatgggacagcccaatgtcca
gacggagaggatgagaccaacgccactgctggacgcaactgcagtatctggaggtgtgct
tctctgagctgtgagcatcgctgtcatgcgtctcctgagggaggaacctgcacatgtcct
tctgggtacactgtcaacaacaataacagccgctcttgtatcgactttgacgactgtcag
atgtggggcgtctgcgaccagctctgtgaagaccggataggaacccatcgctgcagctgt
cgagagggctatttcctggagcagcaccgatactgcagagctaacacctcaactagcgta
gcctcgctggtcttctccaatggccaagacctgctgattggtgacatccatggacacagc
tcacgcaccctggtccattcccagaacagaggagtccctgtcggggtggacttccactac
ctcctcaatagagtcttctggacggatactattcagaacaaggtgttttcggtggatatg
gacggttccaatatgcaggtgattttaaatgtatcagttgactacccagagaacctagcc
gtggactgggtgaacaataagctgtatgtggtggaggccagcgtcaaccggattgacatg
gtggactttgacgggaataaccgggtgacgctgatcgcagagaatctgggaaaccccaga
gggctggccgtggacccaactgtggggttcctgttcttctcagactgggactctctgaat
ggagagccaggtttggagcgggcttacatggatggcaccaatcgctatgggatcatcagg
actaaattgggctggccagcagggatcacactggatattgatgccaagcgagtctactgg
gtcgacagccgctacgactatattgaaaccaccacatatgatgggcttcataggaaaaca
gtggtccatggaggtgctgtgatcccccatccctttggcatcagtctgtttgagcacact
gtgtatttcactgactggaccaagatggccgtgatgaaagccaacaagttcagtgacaca
aaccctcaggtggtctacaccacatctcagaccccacatggagtgcaagtggtacaccaa
ctgaggcaaccatatgtggctaacccttgcggggtagacagggacggctgtgagcagatc
tgtattctaagccacaggtcagacaaccaaggcctgggctaccgctgcaggtgtcgcatg
ggctacgacctgcatgctgatggcaagagatgtgttgcggtgaggcagttccttctcttc
tccagccagctggctgtccgaggcatccccttcaacctgtcctctcaggaggatgtcatc
cttcctgtcactggaacgccctcctacttcgttggggtggacttcagcgcagaggacgat
gccatcttcttctcagacacggccaaagacatcatctacaagcagaaagtggatggcacc
ggcagagaggtgctagctgccaatagagtggacggcgtggaggacttggctttcgactgg
atttcaaagaacctctactggacggacccgcgcttcaggagtatttcagtcatgaaggtg
gccgatcagtccaggagagccatcatacgcaacctgaacaacccaaggtccatcgtggtg
caccctgtgattgggtatattttctggaccgactggtaccgtccagcgaagattatgagg
gcctggtgtgatgggtcacatgctctgtcgattgtgaacactactcttggctggcccaac
ggcctggctatcgactggagctccatgcgcctgtactgggtggatgccttctttgataag
atcgaacacagcacctttgatggacagaacaggctgtctttggagcgcatcactcagatc
tcacatccttttggtctcaccatctttggaggttatgcatatttcactgactggcgcctg
ggtgggatcgtgcgggtgcgcaagactgacgggggagagatggtcatcatcaggcgggga
atcagccacatcatgcacgtcaaaacattcaactacaactcccagaccggttccaacttc
tgcaataggaatactaaccctaatggagactgcagccatttctgcttcccggtgccggac
tcccagagggtgtgtggctgtccgtatggcatgaagctggcgcccagccagcagacgtgt
gtagaggacccttccaacgagccccccacgctgcagtgcggttccaattccttctcctgc
accaatgggaaatgtgtccctcagaactacagatgcgacggcgttgacgattgccatgac
aacagtgatgaggccaactgtggcggcgctcataacaccacctgctcacccagggcattc
acctgtgccaaccagcactgtgtgcccagtggatggcactgtgacgggcacaacgactgc
tttgacagcagtgacgagcaggactgccccacccagacccctggcacctgcgcggccaac
cagttcacctgtgccaacaaccgctgtatcccacacgtctggctgtgcgacacggacaac
gactgtggagacggctcggacgaggccaactgcaacctcagtggtacatgccacccggaa
cagttccagtgcccagaccaccgctgtataggccccagctatgtgtgtgatggtgacaga
gactgtacggatggggctgacgaacagggctgcatttacaactgcactctctatgagttc
aagtgttctaatggacatcagtgtatcaactcctactaccgctgtgatggggtctttgac
tgtagcgatcactcagatgagtctggctgtcatgatcgtgagcctttaccagccaccaga
cccccagggatgtgccaccatgagagtgagttccagtgccagtcggacggcagctgtatc
ccctccacctgggagtgtgacggtcacccggactgtgaggacggctcggacgagcaccac
gtctgtcccctccgcacctgccccaccaccctgttccgctgtgacaacggcaactgtgtg
taccaacggtggctctgcgacggcgacaacgactgtagggacatgagtgacgagagagac
tgccccacaccacctttccgctgccccagctggcagtggcagtgcccgggccacagcatg
tgtgtcaacatcagcagggtgtgtgacaacaatcctgactgccccaatggtgcagacgag
tccccgctctgcaacgagcccttaccagaccaggagagctgcactgacaacaacgcaggt
tgcacccacggctgcatccaggggccgtttggggcccagtgcacgtgtcccatgggctac
cacctgagtaacgactcgaagacgtgtgatgacatagacgagtgtagcccccctggcctg
tgtagccagcattgcttcaacgagagaggctcctttcgctgtcactgctccgacggatac
actctggaggctgaccaacgcacatgcaaggtctcaggttcacgtgaggctttcctttta
gtcgccagccgaaatcagattgtatccgatgacataaccactcagcccaatgtggtccgc
tcgctggtccgggatggacgaaacattgtggcgctggactttgactcagtgactgaccgg
gtgtactggtctgacaccagccaggacagaatatggagcgctcacaaaaatggcagcgac
agggctgtggtttttgacagtggagtgacagtgacagagagcctggcagtggactgggtc
ggtaggaacctatactggactgactacgttctggagaccattgaggtgtccaaactggac
ggcacccacaggactgtcttggtcagtgagaatgtgaccaatcccagagccattgtgctg
gaccctagggacagtgctcacctcatgttctggacagactgggggaggaaccctcgcatt
gagaaggccagtatggacgggaagatgaggacaaccatcataagcaacaaactgtactgg
cccaacggcctaaccattgactatcccaacaatctgctctacttcgcggatgcctacctg
gattttattgactactgtgattacaatggcaaaaacaggaaacaagttctggccagcgat
ctggtactgcaacatccccacgcaattaccatttttgaggattttgtgtattggaccgac
agatacatcaaccgcgttatccgagcccataagtggcacggggagaaccagacagtgatg
ctctacaacctccctcagcccatgggcctggtggcggtacacccgtccaggcagcccgca
ggtgaaaaccactgctttagcagcccctgttctcatatctgtctgctgtcggccgtgggg
cccagcttctactcctgtgcctgcccatcaggctgtaccctggctgcagaccaaatcacc
tgtgccagagttgaggatcctttcttggtggtggtgagagatagtgtcatatacggcatt
cccttgaacccggacgtcaagagcaacgatgccatggtacctgttgctggacttcagaat
ggatacgatgtggactttgacatcactgagcagaccatctattgggtggagcacccgggt
gagatccacagagtgaagtcggacggtaccaacaggacagagtttgccccggcagccatc
ctgggttcccctgtgggcctggccctggactggataacagagaacctgtactacaccaac
ccagccacccagtctattgaggttttgaggctgagaggggagatgcagtacagaaagact
ctaatcaccaataatggctccccgactggcgcaggcactccggttggcatcgctgtggac
ccagcacgcgggaaactgtactggacagaccagggcacagagagtggcatccctgccaag
gtagcagctgcagacttggacggctccaaccctgtcaccctgttcaccaacaacctggat
caggtggagttcatcactgtggacatcagcgagaacaagctgtactgggctgtcacaggc
gctggaatgattgagcgtggcgacccagacgggaccaatcgcatcactatagtgacaggc
ttgtcccatccctggggtgttgctgttcatgagagcttcctgtacttcactgaccgggac
tttgaggtgatagagcgcgtggacaaggccaccggggctaacaaggtggtgctgcgggac
aacgtgtctggactgagagtactgaaggtgcactacagggagacctcggctggtacatcc
aacggctgcagcaacaacatggggctgtgtgagcacctgtgtctaccgcggcccggaggc
ctgtatacctgtgcctgtgctacgggcttcaagctgagcgcggacaacagaacctgtgct
tcataccagtcctacgtggtcatctccatgctgtctgccctcaaaggcttcagtctggag
ggggctgaccactctgaagccatggtgccagtggctgggagaggccgcaatgctttgcat
gtggacgtccacatggcctccgggttcctctactggtgtgacttcagcagcaccgtgaca
tctcagaatggaatccgccggatcaagtctgacggagcagggttcgacagtgtggtcaca
tctggaatcggacgcaacgggatacgaggtatcgctgtggactgggctgcagggaacctc
tatttcacgaatgctttcctgacggagacctatgtggaggttctgcgcttgaacaccact
ttccgacgtgtgctgttgaagactcaagtggacatgccacgccacatcgtggtggaccct
aaaaacagatacctgttctgggcagattacggacagaaccccaagattgagcgagctctg
ctggacgggaccaaccgcactgtgctggtgtcatctgggattataaccccgcgaggtctg
gctctggactaccagactggatatgtctactgggtggatgactctctggatatgatagcc
cgggtcaaccctcagggaggcgagacagaggtagtccggtatgggagtcgttacccgact
ccctatggcatcactgtgtttgagactagcatcatctgggtggacaggaacctgaagaag
gtgttccaggccagtaaggagcctggcagtacagagcagcctgcagtgatcagagacaac
atcaacatgctgagagacgtgactatctacgaccagcgtatccagcccagctcggcccag
cagctcaacaacaatccctgcctggagaccaatggaggctgtgcccacttctgcttcgcc
ctccccgggaaccagaccaagaagtgtggctgtgcctttggcaacctggggacggacaac
gagggctgtgtggtgtcgcgggatgattacctcatctatacaacagagagtgcggtgcag
agcctgcatctggacacggacgaccacggactgcctttccctgtggtcaacgtgcccggc
acctctgtggccctggactttgaccgcacagacaataggatctacttcacccagagctca
ggggctgggagcagcaagattagcttcatcagtctttcctctcctacctcacctccagta
gtggtggcttcagatctaggagctcctgatggtattgcctatgactggatcaataaacgg
atttactacagtgactacatcaaccagactatcaactccatggcagtggacgggacacag
agatccatcatcgctcatgtgcctcggcctagagccataatgctggatccctgcagggga
tatatgtactggacagactgggggacgaatgcgaagattgaacgttctactttgggaggg
aacttcagggcagagattgtaaacagtagtctggtgtggcccaatggactgaccctggac
tatgaagagcagagactgtactgggcagacgccagcctacagaagattgagcgctgctct
ctcaccggggccaatcgggaggtcatcgtcagcacagccatttaccctttcgccatgacc
atgtatggccagtacatctactggactgactggaacacacgcagtatctaccgggctaac
aagcacgatgggtctgaccagagggtgatgacgcagaaccttccatccaggcccatggat
gtccatgtgctggccagcaacaagcagcaacagtgcaacagcccatgtcagcagttcaac
ggaggctgcagtcacatctgtaccccagggccccagggtgctgagtgtcagtgtccctca
gagggtcgctggtacctggccgacaacaagcactgtatccctgacaacgggacccgctgc
caggaaggccagttcacctgtatgaatggacgctgtatccgtgctcagtggaagtgtgac
aatgacaacgactgtggggacggaagcgacgaactggagagagtctgtggatccaagaat
gatttccaaacttccgtccaagtgcaaatggcagcagcatttattgccttgtcagccttc
cacacctgcgagcccactgtgttcacctgtgggaacggtcgctgtgtgccctaccactac
cgctgtgaccactacaacgactgtggggataacagtgatgaggtaggctgccttttcagt
ccgtgcgaccccaacactgagttcccctgcaacaacggacgctgcatctccaaggactac
atctgcaatggcatcaacaactgttatgacaacggcacctcagacgaacaaaactgcccg
gagcgaacatgtcagccagaacacaccaagtgtacatccaccaacatctgcatcccccgc
tcctacctgtgtgacggggacaatgactgtggggacatgagtgatgagagccctacacac
tgtgccacctccacgtgtgcccagaacgagttccgctgctccagtggccgctgtatccca
gcccattggtactgtgatgggggtaccgactgtgctgacggctccgatgagccctcctcc
tgtaccaccctggtgagaacctgcaacactgaccagttcccctgtgacgacggcaggtgc
atcgcttcttcctggatctgcgacggggacaatgattgtggagacatgagtgacgaggac
cagagacacaactgtgacaaccgcacatgctcagtcttggagtttacctgtgtgaataac
caagcgccacagcggaagtgcatccctcgtgattgggtgtgtgacggggatgcggactgt
gcggacgcgttggacgagcaccagaactgcacgcgcagatcgtgtggcgtcaacgagttc
acctgcagcaacggcctctgcatacgcagctcctacaggtgtgaccggaggaatgactgt
ggggacagcagtgacgagcagggctgcacctaccagccgtgtcagcagcaccagttcatc
tgtcaaaacggacgctgtgtgtcccgcgacttcatatgtgatggggacaacgactgcggg
gacgagtccgatgagcttgaccacctgtgccgcacgccaccgcccacgtgcccccccggg
cagttcaggtgtgacaacggacattgtgtccccctcttcaacgtgtgtgaccggaccgac
gactgctcagacaacagtgacgagaagggctgtggtataaatgaatgcaccaacccctcc
atgcaccactgtgaccacaactgcactgacacacccaccagcttcatctgcacctgtcgc
cccggctaccgcctcatgtccgacaacaagacctgcgacgacgtcaacgagtgtgcggag
acgcccagcgtgtgtagtcaggtgtgtgagaacacggtgggctcctacatgtgtaaatgt
gcccccgggttcctacgggaaccggatggccacagctgtcgtcagaacagcaacattacg
ccctacctcatcttcagtaaccgctattatcttcgtaacctgtccacggacggagaggcc
tactccctcatcctgcagggcctgaccagcgtggtggccatggactttgaccgcgtggac
aagaggttctattggattgacgtgagccgcaggttgattgagcggatgttctataacggc
agtaacagggaagtggtggtgaacggggtactccatggagagggcctggcggtcgactgg
gtggccaggaaactctactggctggacagcttcctggactgtctcaaagtgtccgaactg
gacggacgctttgtgaagaaactggctgaacactgtgtggacgccaataacacctactgc
tttgaaaaccccagggcgctcgttctccatcccaaatatggatatgtctactggacggat
tggggggacaaagccttcataggccgtgttggaatggacggcaccaacaagaccacaatc
atcaccactaagatcgagtggcccaatggggtcactatcgactacagcaatgacaagctc
tactggtcggatgcccatctcaactacattgagttctcagacctggagggacatcacaga
cacaccgtgtatgacgggatactgccccatccgtttgccctgactgtgtttgaggagacc
gtgtactggactgactggaacacccgtacagtggagaaaggcaacaaatacgacggatcc
ggccgccagtctctggtcaacaccacacacagacccttcgacatccacgtgtgccatccc
tataggcagcccatagtgaccaacccctgtgcagtgaacaatggaggctgctcccacctg
tgtctgctccgcgacggggggcggggtcacacctgtgaatgccccgaccacttcctgact
ttacagctggggggggtggctcgctgcctgcccatgtgcaccagcacccagtacagatgt
gcggataatgagcgctgcatccccatctggtggaagtgtgacggccagagggactgcaga
gacggctctgatgagccctccacctgccccagtcgccactgccaactgggccagttccag
tgcaacgatggaaactgcaccagcccccacttcctgtgcaacagcaaccaggactgccat
gacggctctgatgaagatcctgtgctgtgtgccactcatcagtgcgagacccaccagtgg
cagtgcaccaataagaggtgcgtccccgaggcgtggcagtgtgacggggaggacgactgt
ggcgacggctctgatgaggagcccacccactgctccagcaggacctgccggcccggacag
tccaagtgccgtaacggacgctgcatcccccagaactggaagtgtgacgtggacgacgac
tgtggcgacaactctgacgagcctctggatgagtgcatggggccgtcgtaccgctgtgac
aaccacacccagtttgactgcaggaccaactaccgctgtgtgccactgtggtctgtgtgc
aacggtcacaacgactgcagggacaacagtgatgagcagggctgcgaggaggtgacctgt
gaccctctgggggacttccgctgtgacaaccaccagtgtgtccctctgcgctggaggtgt
gacggggacaacgactgtggggacagctcggatgagcgtgcctgcagcccgcgtgtgtgc
tccgagagcgagtttcgctgcgataatctgcactgcattcccgaccgctgggtctgtgac
catgacaacgactgcgaggacaactcggatgaaagggactgtgagctgcggacctgtcac
atgggctacttccagtgtggcagtggccactgcatcgccgaccgcttcaaatgtgacggc
aacgccgactgcatggactacactgatgagatatcatgtccaacccgttatcccaatggc
acttattgcccaccgttcctatttgagtgtaggaaccatgtgtgtgtgcagccctactgg
aaatgtgacggagacaacgactgtggagacaattcagatgaggagctccatctctgcttg
gacatcccgtgtgacacgccgttccgtttccgctgtgacaacaaccggtgcatctacagc
catgagctctgcaactctgtcgacgactgtggggacggcactgacgagaaagaggagcac
tgccagacccccacacatgggccatgttcagcagatgagtacaaatgcagtaatggccag
tgcatccctctgcagtatacctgtgatgactatgatgactgtggagaccattctgacgag
ctgggctgcaacgttggcagtgggcgctcctgcagtgacaacatctgtgagcataactgc
acagatctgacagacggaggcttcctctgctcctgcaagcctggatacaaacccagccag
atagacaggaacacctgtgaagacgtgaatgagtgtgaggtctacgggacatgtccacag
gagtgtcagaactccaagggcagttacgagtgcttctgtgcccagggcttccgctcagtc
agcgagcagcatggcatggagtgtgctgctgagggatacccaccagtgctgcttctgccc
gacaatgtgcggattcgttgcttcaacctgtcctcagagcagtattcagactacgtggac
aacatggagcacatccaggctctggactacctgtgggatccagagggcatcggactcagt
attgtgtactggacggtcctgggccgaggctctcagtttggctctatcaagcgggcctac
atgaccactttcaatgacaacggcaataacccagtgaaggagttggatctgaacctgaga
tacattgccaaccctgatggcatcgctgtggactggatcggaggtcacatttactggacc
gacgcagggaccaatcgaattgaagtggcaaagttagatggtcgctacaggaagtggttg
atccatactgacttggaccagccagctgctattgttgtcaacccagcacttggactcatg
tactggacagactggggcaggagacccaggattgagtctgcttggatggacggacagcac
aggcaggttctgttggacgaggacctgggctggcccactggactggctctggactacctg
aatggagacaggatctactggtgtgactccaaggagaacatcatagagtccatgaagccg
gacggaaccgagaggaagatcatcatgtctggagatattggtaatccctacagcctggat
gtctttgagggccatgtgtactggacaaccaaggagcggggtgaagtctggaagacggat
aagtttgggaagggggacaaagtgaaggtgctgaccatcaacccctggctgactcaagtc
cgcatctaccaggagcacagacacaaccgttcagtacccaacccctgtaagaacatgtgc
agtcacctgtgtctgctgcggcctggaggctacacctgcacctgcccacaaggctcctcc
ctggtcggcttcaaccccaacgaatgtgacgcagccattgaggctccagtcttaatgccc
cttgcatgcagatgcatgaacggagggacctgctacactgacgaagggggcctgcccaag
tgcaagtgtccgtatggctatgcagggagttactgtgagatgggaaagtccaggggtgcc
cctgcaggaacagctgttgccgtactgttagcagtgattatcatcctcatcaccggagcg
ttggctgtcggggttttcctcaactacaaacgaactggctccttaatcccatccatgccc
aaactacccagcctgagcagtctggtgaaatcgggtgacactgggaacggggtgacgttt
cgttcgggtgacaatgtcaccatggatctgggacctccacccatcggggtttcattcatt
gacagggccatgcagttggatgaaaactttgccgtggaagcggggaggcagccaatcaca
tttgagaaccccctgtatgccactgcagcggctggatcgtctagtgatcctgctgtcatc
cacgccacacaggtgactgttactgttagcggtgagcagatagagaagaactttgcgaac
ccggcgtaccatacagatcagattgtgtgcaccgtggacagttccacagccagagccaag
cctgttcaggagtccaggtggagcttcttcaaaaggaaatttaagccaagcacaactttt
gaaaaccctacctactcagagatgcagaatgaaaaagcagtaggaagcaatgaggagagt
tcctccaccgacccctctccctttgccccaaccgccaaaccctttaagagggatcgtccc
agcacctactcaccaactgaggacactttccgagacacagcgaaccttgttaaagaggac
agcgatgtgtaa

KEGG   Salmo salar (Atlantic salmon): 106586206
Entry
106586206         CDS       T04363                                 

Definition
(RefSeq) low-density lipoprotein receptor-related protein 2-like
  KO
K06233  low density lipoprotein-related protein 2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106586206
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106586206
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    106586206
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition DUF5050 cEGF SGL EGF_CA hEGF He_PIG IRF-3
Other DBs
NCBI-GeneID: 106586206
NCBI-ProteinID: XP_014028697
UniProt: A0A1S3PM22
LinkDB
Position
ssa25
AA seq 4603 aa
MRSWTEQPGPSIRMWRAVLAKLLIILILCTFRCHSQAGRRCSSEQFSCTNGACIPGEYRC
DRLTDCSDGADETDCHYPECTELRCANGACYNQTQRCDQVVDCRDGSDESNCTQHCSSGL
FQCGNGECVPQRYVCDHDDDCGDRSDEQNCTYPACRGSYFTCPSGRCIHQVWLCDGEDDC
EDNADEKGCDAIPRECYPGEWPCPSSGLCIPMDQLCDGTAQCPDGEDETSTTAGRNCSIW
RCASLSCEHRCHASPEGGTCSCPPGYIVNNNNSRSCIDFDDCTMWGVCDQLCEDRMGTHR
CSCREGYFLEQHRYCSANISTGVPSLIFSNGRDLLIGDIHGHSSRTLVHSRNRGVVVGVD
FHFHLKRVFWTDTIQNKVFSVDMDGSNMQVVLNVSVDYPENLAVDWVNNKLYMVESSVNR
IDMVDFDGNNRVTLIAENLGNPRGLALDPTVGFLFFSDWDSVNGEPGLERAYMDGTNRYG
IIRTKLGWPAGITLDIDAKRVYWVDSRYDYIETTTYDGLHRKTVVHGGAVIPHPFGISMF
EHIVYFTDWTKMAVMKANKFSDTNPQVVYTTSQTPHGVQVVHQLRQPYVSNPCGANRGGC
EQICILSHRSDNQGLGYRCRCCMGYDLHADGKRCVAVRQFLLFSSQLAVRGIPFNLSSQE
DVILPVTGTPSYFVGVDFSAEDNAIFFSDTAKDIIYKQKVDGTGREVLAANRVDGVEDLA
YDWISKNLYWTDPRYRSISVMKLADQSRRAIIRNLNSPRSIVVHPVIGYIFWTDWYRPAK
IMRAWCDGSHALSIVNTTLGWPNGLAIDWSSMRLYWVDAFFDKIEHSTFDGRNRLSLERI
TQISHPFGLTIFGGYAYFTDWRLGGIVRVRKTDGGEMVIIRRGISHIMHVKSFNSNSQTG
SNFCSRNTNPNGDCSHFCFPAPDSQRVCGCPYGLKLAPNQQTCVEDPSNEPPTLQCGANS
FSCTNGKCVPQNYRCDGVDDCHDNSDEANCGRAHNTTCSPRAFTCANQQCVPSGWHCDGH
NDCFDGSDERDCPTQNPGTCPANQFTCANHRCIPHTWVCDTDNDCGDSSDEANCNLSGSC
HPEQFQCPDHRCIGPSYVCDGDRDCMDGADEQGCIYNCTLYEFKCSNGHQCINSYYRCDG
VFDCSDRSDESGCPTRPPGMCHHESEFQCQSDGSCIPSTWECDGHPDCEDGSDEHHVCPP
RTCPTTLFRCDNGNCVYRGWLCDGDNDCRDMSDERNCPTPPFRCPSWQWQCPGHSVCVNI
SRVCDNNPDCPNGADESPLCNEPLPDQESCTDNNAGCTHGCIQGPFGAQCTCPLGYQLSN
DWKTCDDLNECNPPGLCSQHCFNERGSFRCHCSDGYTLEADQHTCKVSGSREAFLLVASR
NQIVSDDITTQPNVVRSLVRDGRNIVALDFDSVTDRVYWSDTSQDRIWSAHKNGSDRAVV
FDSGVTVTESLAVDWVGRNLYWTDYVLETIEVSKLDGTHRTVLVSENVTNPRALVLDPRD
SAHLMFWTDWGRNPRIEKASMDGKMRTTIISNKLYWPNGLTIDYPNNLLYFADAYLDFID
YCDYNGNNRKQVLASDLVLQHPHAITIFEDFVYWTDRYINRVIRAHKWHGENQTVMLYNL
PQPMGLVAVHPARQPAGENHCLRRLCTHICLLSAIGPSYYSCACPSGWTLTADNFTCARV
EDPFLVVVRDSVIYGMSLNPDDKSNDAMVPVAGLQNGYDVDFDDIERTIYWVEHPGEIHR
VKSDGTNRTEFAPAAILGSPVGLALDWMAENLYYTNPATQSIEVLRLRGEVQYRKTLITN
NGSPTGAGSPVGIAVDPARGKLYWTDQGTESGIPAKVAAADMDGSNPVILFTNNLDHVEF
ITVDIQENKLYWAVTGTGMIERGDPDGTNRITIVTGLSHPWGVAVHERFLYFTDRDFEVI
ERVDKATGANKVVLRDNVSGLRVLKVHYREISAGTSNGCSNNIGACEHLCLPRPRGLYTC
ACATGFKLSVNNRTCAPYQSYVVISMLSALKGFSLEGADHSEAMVPVAGRGRNALHVDIH
MPSGFLYWCDFSSTVTSQNGIRRIKPDGAGFRSVVTSGIGRNGIRGIAVDWAAGNLYFTN
AFLTETYVEVLRLNTTFRRVLLKTQVDMPRHIVVDPKNRYLFWADYGQNPKIERALLDGT
NRTVLVSSGIITPRGLALDFQTGYVYWVDDSLDMIARVNPQGGETEIVRYGSRYPTPYGI
TVFETSIIWVDRNLKKVFQASKEPGSTEQPTVIRDNINMLRDVTIYDQRIQPSSAQQLNN
NPCLQTNGGCAHFCFALPGSQTKKCGCAFGNLGADNAGCVVSRDDYLIYTTESTVRSLRL
DPDDHALPFPVVNVPRTSVALDFDRTDNRIYFTQSSGAGSSKISYISLSSPTSPPVAVAS
DLGAPDGIAYDWINKRIYYSDYINQTISSMALDGTQRSIIARVLRPRAIMLDPCRGYMYW
TDWGTNAKIERATLGGNFRTEIVNSSLVWPNGLTLDYEEQRLYWADASLQKIERCSLTGA
NREIIVSTAIYPFAMTMYGQYIYWTDWNTRSIYRANKHDGSDQRVMTQNLPSRPMDVHVL
ASNKQQQCNSPCQQFNGGCSHICTPGPQGAECQCPSEGRWYLADNKHCIPDNGTRCQAGQ
FTCMNGRCIRAQWKCDNDNDCVDGSDELERVCGSKNDFQPFAFHTCEPTVFTCGNGRCVP
YHYRCDHYNDCGDNSDEVGCLFRLCDPNTEFPCNNGRCIAKDYVCNGINNCFDNGTSDEQ
NCPERTCPPEHTKCASNNICIPRSYLCDGDNDCGDMSDESPVHCATSTCAQNEFHCSSGR
CIPAHWYCDGGTDCADGSDEPSSCITLVRTCNTDQFRCDGGRCITSSWVCDGDNDCGDMS
DEDQRHNCANRTCSVLEFTCVNNLGPQRKCISRDWVCDGDADCADALDEHQNCTRRSCGV
NEFTCSNGLCIRSSYRCDRRNDCGDSSDEQGCTYQPCQQHQFTCQNGRCVSLAFICDGDN
DCGDESDELEHMCRTPPPTCPPGQFRCDNGHCVPLFNVCDRTDDCSDNSDEKGCGINECT
NPSMHHCDHNCTDTPTSFICTCRPGYRLMSDNKTCDDVNECAETPSVCSQVCENTVGSYM
CKCAPGFLREPDGRSCRQNSHITPYLIFSNRYYLRNLSTDGEAYSLILQGLTSVVAMDFD
RVDKRFYWIDVGRRVIERMFYNGSNREVVVNGVVHGEGLAVDWVGRKLYWLDSFLDCLKV
SELDGRFAKKLAEHCVDANNTYCFENPRALVLHPKYGYVYWTDWGEKAFIGRVGMDGTNK
TAIITTKIEWPNGVTIDYSNDKLYWSDAHLNYIEFSDLEGHHRHTVYDGTLPHPFALTVF
EETVYWTDWNTHTVEKGNKYDGSGRQSLVNTTHRPFDIHVCHPFRQPIVTNPCADNNGGC
SHLCLIRDGGRGHTCECPDHFLNVQLGGVARCLPMCTSTQYRCADNERCIPIWWKCDGQR
DCRDGSDEPSTCPSRHCRLGQFQCNDGNCTSPHFLCNSNQDCHDGSDEDPVLCATHQCET
HQWQCANKRCIPEAWQCDGDDDCGDGSDEEPAHCSSRTCRPGQFKCRNGRCIPQNWKCDV
DDDCGDNSDEPLEECMGPSYRCDNHTQFVCRTNYRCVPQWSVCNGHNDCRDNSDEQHCEE
VTCNPLGDFRCDNHQCVPLRWRCDGDNDCGDGSDERACSPRVCSESEFRCDNLHCIPGRW
VCDHDNDCEDNSDERDCELRTCHPGYFQCGSGHCIADRFKCDGNADCLDYTDETSCPTRY
PNGTYCPLFLFECRNHVCVQPYWKCDGDNDCGDHSDEELHLCLDIPCDPPFRFRCDNNRC
IYSHELCNSVDDCGDGTDEKEEHCQTPTHGPCSADQFKCSNGQCIPLQYACDDYDDCGDH
SDELGCNVGSGRSCSENICEHNCTDLTDGGFLCSCRPGYKPSQTDRNTCEDVNECEVYGT
CPQECQNSKGSYECFCAQGFRSVSEQHGIECAAEGNPPVLLLPDNVRIRRFNLSSEQYSD
YVDNAEHIQALDYQWDPEGIGLSIVYWTVLGRGSQFGSIKRAYMTTFNDNGNNPVKELDL
NLRYVANPDGIAVDWVGGHIYWTDAGTNRIEVAKLDGRYRKWLIHNDLDQPAAIVLNPGL
GIMYWTDWGRRPRIESAWMDGQHRQVLLDEDLGWPTGLTLDYLNGDRIYWCDSKENIIES
MKPDGTERKIIMSGDIGNPYSLDVFEGHVYWTTKERGEVWKADKFGKEEKVKVLTINPWL
TQVRIYQEHRYNRSVPNPCKDVCSHLCLIRPGGYTCTCPQGSSLVGFNPNECDAAIEVPV
LMPLACRCMNGGTCYTDEGGLPKCKCQYGYAGAYCEMGKSRDAPEGAGTVKTVAALLAVI
IFIITGALAVGVFLNYKRTGSLMPSMPNLPSLSSLVKSGDTGNGVTFRSGDNVTMDLGPP
PIGVSFIDRAMQLDGNSAVEAGRPITFENHLYAHGATGSSSDPAVIHATQVTVTVSGEQI
EKNHKEQIVSTVDSSTARAKPVQESMWSAFRRKLKPSLTFENPIYSEMQNEKAVGSNEES
SSTDPSPFAPTTKRLKRDYPSTYSPTEDTFQDTANLVKEDNDV
NT seq 13812 nt   +upstreamnt  +downstreamnt
atgaggagctggacggaacagccgggacccagcatcagaatgtggagagcagtgcttgca
aaacttcttattatattgattttgtgtactttccggtgtcattcacaagctggtaggaga
tgctccagtgaacagttcagctgcaccaatggggcctgcatcccaggggagtacaggtgt
gaccggctgaccgactgctccgacggggctgatgagacagactgccactaccctgagtgt
acagaactgaggtgtgccaatggtgcctgttataaccagactcagcgctgtgaccaggtc
gtggactgccgtgacgggtcagacgagtccaactgcacacagcactgcagcagtggcctg
ttccaatgtggcaacggagagtgtgtccctcaacgctacgtctgcgaccatgacgacgac
tgtggagacaggagtgacgaacagaactgcacctatcccgcttgcagagggagctacttc
acttgccccagtggtcgctgtattcaccaagtctggctttgtgatggagaagacgactgt
gaagacaatgcagatgagaaaggctgtgatgccataccacgtgagtgctatcctggagaa
tggccctgtccgtcctcgggcctgtgtatccccatggaccaactgtgtgatgggacagcc
caatgtccagatggagaggatgagaccagcaccactgctggacgcaactgcagtatctgg
aggtgtgcctcgctgagctgtgagcatcgctgtcatgcgtcccccgagggaggaacctgc
tcatgtcctcctggatacattgtcaacaataacaacagccgctcttgtatcgactttgat
gactgtacaatgtggggcgtctgcgatcagctctgtgaagacaggatgggaacccatcgc
tgcagctgtcgagagggctatttcctagagcagcaccgatactgcagcgctaacatctca
actggagtaccctcgctgatcttctccaacggccgagacctgctgattggtgacattcat
gggcacagctcacgcaccctggtccattcccggaacagaggtgtcgttgtcggggtggac
ttccacttccacctcaaaagagtcttttggacagatactattcagaacaaggtattttcg
gtggatatggacggttccaatatgcaggtggttttaaatgtatcagttgactaccctgag
aacctggccgtggactgggtgaacaataaactgtatatggtggagtcaagcgtcaaccgg
attgacatggtggattttgacgggaataaccgggtgacgctgatcgcagagaatctggga
aaccccagagggctggctctggacccaactgtggggttcctgttcttctcagactgggac
tctgtgaatggagagccaggtttggagcgggcatacatggatggtaccaatcgctatggg
atcatcaggactaaattgggctggccagcagggatcacactcgatattgatgccaagcgg
gtctactgggtcgacagccgctacgactatattgaaaccaccacatatgatgggcttcat
aggaaaacagtggttcatggaggtgctgtgattcctcacccctttggcatcagtatgttt
gagcacattgtgtatttcactgactggaccaagatggccgtgatgaaagccaacaagttc
agtgacactaaccctcaggtggtctacactacatctcagaccccacatggagtgcaagtg
gtacaccaactaagacaaccgtatgtgtcgaacccttgcggggcaaacaggggcggctgt
gagcagatctgtattctaagccacaggtcagacaaccaagggctgggctaccgctgcagg
tgttgcatgggctacgacctgcatgctgatggcaagagatgtgttgcggtgcggcagttc
ctgctcttctccagccagctggctgtccgaggcatccccttcaacctgtcctctcaggag
gatgttatcctccctgtcactggaacaccctcctatttcgttggggtggacttcagcgcc
gaagacaatgctatcttcttctcagacacggctaaagacatcatctacaaacagaaagtg
gacggcaccggcagagaggtgctagctgccaatagagtggacggcgtggaggacttggct
tacgactggatttcaaagaacctctactggacagacccgcgctacaggagtatttcagtc
atgaagctggccgatcagtccaggagagccatcatacgcaacctgaacagccccaggtcc
atcgtggtgcaccctgtgattgggtatattttctggaccgactggtatcgtccagcgaag
attatgagggcctggtgtgatgggtcacatgccctgtcgattgttaacactacacttggc
tggcccaacggcctggctatcgactggagctccatgcgcctctactgggtggatgccttc
tttgataagatcgaacacagcacctttgatggacggaacaggctgtctctggagcgcatc
actcagatctcacatccttttggtctcaccatctttggaggttatgcatatttcactgac
tggcgcctgggtgggatcgtgcgcgtgcgcaagactgacgggggagagatggtcatcatc
aggaggggaatcagccacatcatgcacgtcaaatctttcaactccaactcccagaccggt
tccaacttctgcagtaggaatactaaccctaatggagactgcagccatttctgcttcccg
gcaccggactcccagagggtgtgtggctgtccgtatggcttgaagctggcgcccaaccag
cagacgtgtgtagaggacccttccaacgagccccccacgctgcagtgtggtgccaactcc
ttctcctgcaccaacgggaaatgtgtccctcagaactacagatgcgatggcgttgacgat
tgccatgacaacagtgatgaggccaactgtggaagagctcataacaccacctgctcaccc
agggcgttcacatgtgccaaccagcaatgtgtgcccagtggttggcactgcgacgggcac
aacgactgcttcgacggcagtgacgagcgggactgccccacccagaaccctggcacctgc
ccggccaaccagttcacctgtgccaaccaccgctgcatcccacacacctgggtgtgtgac
acagacaacgactgtggggacagctccgacgaggccaactgcaacctcagtgggtcatgc
cacccggaacagttccagtgcccagaccaccgctgtataggccccagctatgtgtgtgac
ggagacagagactgtatggatggggctgatgaacagggctgcatttacaactgcactctc
tatgagttcaagtgttccaatggacatcagtgtatcaactcctactaccgctgtgatggg
gtctttgactgtagtgatcgctcggatgagtctggctgtcccaccagacccccagggatg
tgccaccatgagagtgagttccagtgccagtcggacggcagctgtatcccctctacctgg
gagtgtgacggtcacccggactgtgaggacggctcagacgagcaccacgtctgtcccccc
cgcacctgccccaccaccctgttccgctgtgacaacggcaactgtgtgtaccgcgggtgg
ctctgcgatggggacaacgactgtagggacatgagtgacgagagaaactgccccacgcca
cctttccgctgccccagctggcagtggcagtgcccgggccacagcgtgtgtgtcaacatc
agcagggtgtgtgacaacaatcctgactgtcccaatggtgcggacgagtccccgctctgc
aacgagcccttgccagatcaggagagctgcacagacaacaacgctggttgcacccacggc
tgcatccagggtccgtttggggcccagtgcacatgtcccctgggttaccagctgagtaat
gactggaagacgtgtgatgacctgaatgagtgtaacccccctgggctgtgtagtcagcac
tgcttcaacgagagaggctccttccgctgtcactgctcagatggatacactctggaggct
gaccaacacacatgcaaggtctcaggttcacgtgaggctttcctgttagttgccagccga
aatcagattgtgtccgatgacataaccactcagcccaatgtggtccgctcgctggtccgg
gatgggcgaaacatcgtggccctggactttgactcggtgactgaccgtgtgtactggtct
gacaccagccaggacagaatatggagcgctcacaaaaatggctctgacagggccgtggtt
tttgacagtggagtgacagtgacagagagcctggcagtggactgggtgggcaggaatctc
tactggactgactatgttctggagaccatcgaggtgtctaaattggacggcacccacagg
actgtgttggtcagtgagaacgtgaccaatcccagagccctggtgctggacccaagggac
agtgctcacctcatgttctggacagactgggggaggaaccctcgcattgagaaggccagc
atggacgggaagatgaggacaaccatcataagcaacaaactgtactggcccaacggccta
accattgactatcccaacaatctgctctacttcgctgatgcctacctggattttattgac
tactgtgattacaatggcaacaacaggaaacaagttctggccagcgatttggtactgcaa
catccccacgcaattaccatttttgaggattttgtgtattggaccgacagatacatcaac
cgtgtgatccgagcccataagtggcacggggagaaccagacagtgatgctctacaacctc
cctcagcccatgggcctggtggcggtacacccggccaggcagcctgcaggtgaaaaccac
tgcttgaggaggctttgtactcatatctgcctgctctcggccattgggcccagctactac
tcctgtgcctgtccctcaggctggaccctgactgcagacaatttcacctgtgccagagtt
gaggatcctttcttggtggtggtgagagacagtgtcatctacggcatgtccttgaacccg
gacgacaagagcaacgatgccatggtcccagttgctggacttcagaatggatatgatgtg
gactttgacgacattgagcggaccatctattgggtagagcacccgggtgagatccacaga
gtgaagtcggacggtaccaacaggacagagtttgccccggcagccattctgggttcccct
gtgggcctggccctggactggatggcagagaacctgtactacaccaacccagccacccag
tctattgaggttttgagactgagaggggaggtgcagtacagaaagactctaatcaccaat
aatggctccccgactggcgcaggctctccggttggcattgctgtggacccggcacgtggg
aaactgtactggacagaccagggcacagagagtggcatccctgctaaggtggcggctgca
gacatggacggctccaaccctgtcatcctgttcaccaacaacctggatcatgtggagttc
atcactgtggacatacaagagaacaagctgtactgggctgtcacaggcaccggaatgatt
gagcgtggcgacccagacgggaccaatcgcatcacaatagtgacaggcttgtcccatccc
tggggcgttgctgttcatgagcgcttcctgtacttcaccgaccgggactttgaggtgata
gagcgagtggacaaggccaccggggctaacaaggtggtgctgcgggacaacgtgtctgga
ctgagagtactgaaggtgcactacagggagatctcggctggtacctctaacggttgcagc
aacaacattggtgcgtgtgagcacctgtgtctaccgcggcccagaggcctgtatacctgt
gcctgtgctactggcttcaagctcagcgttaacaacaggacctgtgctccataccagtcc
tacgtggtcatctccatgctgtctgccctcaaaggcttcagtctggagggggctgaccac
tctgaggccatggtgccagtggctgggagaggacgtaatgctctacatgtggatatccac
atgccctcggggttcctctactggtgtgacttcagcagcactgtgacttctcagaacggg
atccgccggatcaagcccgatggagcagggttccgcagtgtggtcacatctggaatcggc
cgcaacgggatacgaggcatcgctgtggactgggctgcagggaacctctatttcacgaat
gctttcctgacggagacctatgtggaggttctgcgcttaaacacaactttccgacgtgtg
ctgttgaagactcaagtggacatgccacgccacatcgtggtggaccctaaaaacagatac
ctgttctgggcagattacggacagaaccccaagattgagcgagctctgctggacgggacc
aaccgcactgtgctggtgtcgtctgggattataaccccgcgaggtctggctctggacttc
cagactggatatgtctactgggtggatgactctctggatatgatagcccgggtcaaccct
caggggggagaaacagagatagtcaggtacgggagccgctacccaactccctatggcatc
actgtgtttgagactagcatcatctgggtggacaggaacctgaagaaggtgttccaggcc
agtaaggagcctggcagtacagagcagcctacagtcatcagagacaacattaacatgctg
agagacgtgactatctacgaccagcgtatccagcccagctcggcccagcagctcaacaac
aacccctgcctgcagaccaacgggggctgtgcccacttctgctttgccctccccgggagc
cagaccaagaagtgtggctgtgcctttgggaacctgggggcggacaacgcgggctgtgtg
gtgtcgcgggatgattacctcatctatacgacagagagcacggtgcggagtctgcgtctg
gacccggacgaccacgcactgcccttccctgtggtcaacgtgccccgcacctccgtggcc
ctggactttgaccgcacagacaataggatctacttcacccagagctcaggggctgggagc
agcaagattagctacatcagtctgtcctctcccacctcacctccagtagcggtggcttct
gatctaggagctcctgatggtattgcctatgactggatcaacaaaaggatttactacagt
gactacatcaaccagacaatcagctccatggcattggacgggacacagagatccatcatc
gcccgcgtgctccgacctagagccatcatgctggatccctgcagggggtatatgtactgg
acagactgggggaccaatgcaaagattgaacgtgctactttgggagggaacttcaggaca
gagattgtaaacagcagtctagtgtggcccaatggactaaccctggactatgaagagcag
agactgtactgggcagatgccagcctacagaagattgagcgctgctctctcactggggcc
aatcgggagatcatcgtcagcacagccatttacccattcgccatgaccatgtatggccag
tacatctactggactgactggaacacacgcagtatctaccgggctaacaagcacgatggg
tctgaccagagggtgatgacacagaaccttccatccagacccatggatgtccacgtgctg
gccagcaacaagcagcaacagtgcaacagcccttgtcaacagttcaacggaggctgcagt
cacatctgtaccccagggccccagggtgctgagtgtcagtgtccctcagagggtcggtgg
tacctggccgacaacaagcactgtatccctgacaacgggacccgctgccaggcaggccag
ttcacctgtatgaatggacgctgtatccgtgctcagtggaagtgtgacaatgacaatgac
tgtgtggacggaagcgacgagctagagagagtctgcggatccaagaatgatttccaacct
tttgccttccacacttgcgagcccactgtgttcacctgtgggaacggtcgctgtgtgccc
taccactaccgctgtgaccactacaacgactgtggcgacaacagtgatgaggtaggctgc
ctgttcaggttgtgcgaccccaacactgagttcccctgcaacaacggacgctgcatcgct
aaggactacgtctgcaacggcatcaacaactgctttgacaatggcacttcagacgaacaa
aactgcccggagcgaacatgtccgccagaacacaccaagtgtgcatccaacaacatctgc
atcccccgctcctacctgtgtgacggggacaatgactgtggggacatgagtgacgagagc
cctgtacactgcgccacttccacgtgtgcccagaatgagttccactgctccagtggccgc
tgtatcccagcccactggtactgtgatgggggtaccgactgtgctgacggctctgatgag
ccctcctcctgcatcaccctggtgagaacctgcaacaccgaccagttccgctgtgatggc
ggcaggtgcatcacctcttcctgggtctgcgatggggacaatgactgtggagacatgagt
gatgaggaccagagacacaactgtgctaaccgcacatgctcagtcttggagtttacctgt
gtgaacaacctagggccacagaggaagtgcatctctcgtgattgggtgtgtgacggcgat
gcggactgtgcggacgcgttggacgagcaccagaactgcacgcgcagatcgtgtggcgtc
aacgagttcacctgcagtaacggcctctgcatacgcagctcctacaggtgtgaccggagg
aatgactgtggggacagcagtgacgagcagggctgcacctaccagccgtgtcagcagcac
cagttcacctgtcaaaacggacgctgtgtgtccctcgccttcatctgtgacggggacaac
gactgcggggacgagtcggatgaactagaacacatgtgccgcacgccaccgcccacgtgc
ccccctgggcagttcaggtgtgacaacggacactgtgtccctctctttaacgtgtgtgac
cggaccgacgactgctcagacaacagtgacgagaagggctgtggtataaatgaatgcacc
aacccctccatgcaccactgcgaccataactgcactgacacacccaccagcttcatctgc
acctgtcgccccggctaccgcctcatgtccgacaacaagacctgcgacgacgtcaacgag
tgtgcggagacgcccagcgtgtgtagtcaggtgtgtgagaacaccgtgggctcctacatg
tgtaaatgcgcccccgggttcctacgggaaccggatggccgcagctgtcgtcagaacagc
cacatcacaccctacctcatctttagtaaccgctattatcttcgtaacctgtccacggac
ggagaggcctactccctcatcctgcagggcctgaccagcgtggtggccatggactttgac
cgcgtggacaagaggttctattggattgacgtgggccgcagggtgattgagcgaatgttc
tataacggcagtaacagggaagtggtggtgaacggggtggtccatggggagggcctggcg
gtcgactgggtgggcaggaagctctactggctggacagcttcctggactgtctcaaagtg
tccgaactggacgggcgctttgctaagaaactggctgagcactgtgtggatgccaataat
acctactgctttgaaaaccccagggcgctcgttctgcatccaaaatatggatatgtctac
tggacggattggggggagaaagccttcataggccgtgttggaatggacggcaccaacaag
acagccatcatcaccactaagatcgagtggcccaatggggtcaccattgactacagcaat
gacaagctctactggtcagatgcccatctcaactacatcgagttctcagacctggaggga
catcacagacacactgtgtatgacgggacactgccccatccatttgccctgactgtgttt
gaggagaccgtgtactggactgactggaacacccacacagtggagaaaggcaacaaatac
gacggatccggccgccagtctcttgtcaacaccacacacagacccttcgacatccacgtg
tgccatccctttaggcagcccatagtgaccaacccctgtgcagataacaatggaggctgc
tcccacctgtgtctgatccgtgacggggggcggggtcacacctgtgaatgccccgaccac
tttctgaatgtacagctgggtggcgtggctcgctgcctgcccatgtgcaccagcacccag
tacagatgtgcggataatgagcgctgcatccccatctggtggaagtgtgacggccagagg
gactgcagagacggctctgatgagccctccacctgccccagtcgccattgccgactgggc
cagttccagtgcaacgatggaaactgcaccagcccccacttcctgtgcaacagcaaccag
gactgccatgatggctctgatgaagatcctgtgctgtgtgccactcatcagtgcgagacc
caccagtggcagtgcgccaataagaggtgcatccccgaggcgtggcagtgtgacggggac
gacgactgtggcgacggctctgacgaggagcccgcccactgctccagcaggacctgccgg
cccggacagttcaagtgccgtaacggacgctgcatcccccagaactggaagtgtgacgtg
gacgacgactgtggcgacaactctgacgagcctctggaagagtgcatggggccgtcttat
cgctgtgacaaccacacccagtttgtctgcaggaccaactaccgctgtgtgccacagtgg
tctgtgtgcaatggccacaacgactgcagggacaacagtgatgagcagcactgcgaggag
gtgacctgtaaccctctgggggacttccgctgtgacaaccaccagtgtgtccctctgcgc
tggaggtgtgacggggacaacgactgtggcgacggctcggatgagcgcgcctgtagcccg
cgtgtgtgctcggagagcgagtttcgctgcgacaatctgcactgcattcccggccgctgg
gtctgtgaccatgacaacgactgtgaggacaactcagatgaaagggactgtgagctgcgg
acctgtcacccgggctacttccagtgtggcagtggccactgcattgccgaccggttcaaa
tgtgacggcaacgccgactgcctggactacactgacgagacatcatgcccaacccgttat
cccaatggcacgtattgcccactgttcctgtttgagtgtaggaaccatgtgtgtgtgcag
ccctactggaaatgtgacggagacaacgactgtggagaccactcagatgaggagctccac
ctctgcttggacatcccgtgtgacccgccgttccgtttccgctgtgacaacaaccggtgc
atctatagccatgagctctgcaactcggtggacgactgtggggacggcactgacgaaaaa
gaggagcactgccagaccccaacacatgggccctgttcagcagatcagttcaaatgcagt
aatggccagtgcatccctctgcagtatgcctgtgatgactatgatgactgtggagaccat
tctgacgagctgggctgcaatgttggcagtgggcgctcctgcagtgagaacatctgtgag
cacaactgcacagacctgacagacggtggcttcctctgctcctgcaggcctggatacaaa
cccagccagacagacaggaacacctgtgaagacgtcaacgagtgtgaggtctacgggacg
tgtccacaggagtgtcagaactccaagggaagctacgagtgtttctgtgcccagggcttc
cgctcagtcagcgagcaacatggcattgagtgtgctgctgagggaaacccaccagtgctg
cttctgcctgacaacgtgagaattcgccgcttcaacttgtcatcggagcagtattcagac
tacgtggacaacgccgagcacatccaggctctggactaccagtgggatccagagggcatt
ggactcagtattgtgtactggacggtcctgggccgaggatctcagtttggctctatcaag
cgagcctacatgaccacattcaatgacaacggcaataacccagtgaaggagttggatctg
aacctgagatatgttgccaaccctgatggtatcgctgtggactgggtcggaggtcacatt
tactggacagacgcagggaccaatcgaattgaagtggcaaagctagatgggcgctacagg
aagtggttgatccataatgacctggaccagccagctgctattgttttgaatccaggactc
ggaatcatgtactggacagactggggcaggagacccaggattgagtctgcctggatggac
gggcaacacaggcaggttctgttggacgaggacctgggctggcccactggactgactctg
gactacctgaatggagacaggatctactggtgtgactccaaggagaacatcatagagtcc
atgaagccggacggcaccgagaggaagatcatcatgtcaggagatattggtaatccctac
agcctggatgtctttgagggccatgtgtactggacaaccaaggagcgaggtgaagtctgg
aaggctgataagtttgggaaggaggaaaaagtgaaggtgctgaccatcaacccctggctg
actcaagtccgcatctaccaggagcatagatacaaccgctcagtgcccaacccctgtaag
gatgtctgcagtcacctgtgtctgatccggcctggaggctacacctgcacctgcccccaa
ggctcatccttggtgggcttcaaccccaacgaatgtgatgcagccattgaggttccagtc
ttaatgccccttgcatgcagatgcatgaacggagggacctgctacactgacgaagggggc
ctgcccaagtgcaagtgtcagtatggctatgcaggggcttactgtgagatgggaaagtcc
agggatgcccctgaaggagcaggtacagtaaaaacagttgcggcactgttagcagtgatt
attttcatcatcaccggagcgttggctgtcggggttttcctcaactacaaacgaactggc
tccttaatgccgtccatgcccaatctacccagccttagcagtctggtgaaatcgggtgac
acgggcaatggggtgacgtttcgctcgggtgacaatgtcacaatggatctgggacctcca
cccatcggggtgtcattcattgacagggccatgcagttggatgggaactccgcagtggaa
gcggggaggccaatcacgtttgagaaccatctgtatgcccatggagcaactggatcgtct
agtgatcctgctgtcatccacgccacacaggtgactgttactgttagcggcgagcagatc
gagaagaaccataaagagcagattgtgagcaccgtggacagttcaacagccagagccaag
cctgttcaggagtcaatgtggagtgccttcagaagaaaattgaagccaagcttaactttt
gaaaaccctatctactcagagatgcagaatgaaaaagcagtaggaagcaatgaggagagt
tcctccactgacccctctccctttgccccaaccaccaaacgcctgaagagggattatccc
agcacctactcaccaactgaggacactttccaagacacagcaaacctcgtcaaagaggac
aacgatgtatga

KEGG   Salmo salar (Atlantic salmon): 106590470
Entry
106590470         CDS       T04363                                 

Definition
(RefSeq) brother of CDO-like
  KO
K20020  brother of CDO
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106590470
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 fn3 ig C2-set_2 V-set Pur_ac_phosph_N Ig_4 Ig_5 G6B
Other DBs
NCBI-GeneID: 106590470
NCBI-ProteinID: XP_014037006
UniProt: A0A1S3QAJ7
LinkDB
Position
ssa29
AA seq 1070 aa
MSGTLDWTPWMKKRRARVLSALSAVLLCCIQSGATVSGTSDEVPVFTEEPLSVVQKLGGR
VILRCSTQPPSANISWWLNGRELVAGAGGDLGVVLEPGTLLIPALTNLTLGRYQCVASTN
AGALASVSANVTAAKLRDFEQDDQQDIEVDEGNTAVIVCHLPESQPKAQVRYSVKQEWLE
TSKGNYLIMPSGNLQIANATLDDEGPYKCAAYNPVTQEVKTSTSTDRLRIRRSTPEAAHI
IYPPVSRSIMVTKGQRLVLECVASGIPTPQVTWAKDGQDLRFHNNTRFLLSNLLIDSAGE
GDSGTYACHADNGIGSESAATVLYDVLVFEPPQVTVEVQQQEVMWGENVRFSCQARGKPT
PSVVWLHNARPLATSPRHRLSARVLRVINVGPQDDGLYQCMAENGVGSSQAAARLVTLPT
SNPSRSGKLPSNLRPLSPDKVLWEQVPVKPGATGSVLTLDCSGLTGQISVAEAPVILSQP
RTVKADFYDLTWKPRHDGGSAVVEYIVKYRKIEDPPGEWTSSCISGSLHKLTLAKLQPAS
LYEVEMSAKNCAGLGQPAMMTFRTGKGRRGPGGQNEPPKTPAVPSPRLSPPEAPDKPTIS
TATETSAYVTWIPRGNRGFPIQSFRVEFKKLKGKGGGEWEVAVTNIPPQRLSVEITGLEK
GMSYKFRVLAVNVIGASPPSVPSKAYTVLGGGRPNERPVDGPYITYNEAINETTIILKWT
YTAVNNTPVYGFYIFYRPTDSDNDSDYKKDVVEGDRYWHSITDLQPETAYDIKMQSFNEG
GESEFGNVVILETKARLNQRPSPPETWSQRPEHSGGPAPRPSDLPYLIVGVVLGALVFII
VAFIPFCLWRAWAKEKEMSDLCFPAVASPVSSCQYTMVPLQGLALVGHCPLDPHLPPPHA
VYPPIGLYTSNGKHHRPTHCLPGLHQEDVEYDMECGTLLAQTMSNGHVPVYHYSNSEPEH
HGDREDHCFLPDDSTLQLLNTSEQPISSQDLTGNARFYNGDIIREKDINQVPSVCVDLPC
SPCPLLSLEEENSKATTSAATTAESQDALPLQEVNTLQSETPPVEQGTSD
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtctggaacattagactggactccgtggatgaaaaagcgacgggcacgagtgctgagt
gctctgagtgcagtgctgctgtgctgcatacagagcggcgccaccgtcagtggtaccagt
gatgaagtaccagtgttcacagaggagcctctgtcggtggtccagaagctagggggaaga
gtgattctgaggtgcagcacccaacccccctcagccaacatcagctggtggctaaacggg
cgcgagctggttgccggggctggcggggacctgggggtggtactggagcctggcacgctg
ctcatcccagccctcaccaacctcaccctgggcaggtaccagtgtgtggccagcaccaac
gcaggggccctggccagtgtgtctgccaacgtcaccgctgccaagttgcgtgactttgaa
caagacgaccagcaggacattgaggtggatgaggggaacacggctgtgatcgtatgtcac
ctccctgagagccagcccaaggcccaggtccgctacagtgtcaaacaggagtggctcgag
acctccaaggggaactacctgatcatgccatcagggaacctgcagatagccaacgccact
ctggacgacgaggggccttacaagtgtgctgcttacaaccctgtcacacaggaagtcaag
acctccacctccactgaccgcctgcgcatacgccgttcaacaccagaggcggcccatatc
atctaccccccagtgtctcgctccatcatggtcactaagggacagcgtctggttctggag
tgtgtggccagcggcattcccaccccgcaggtcacatgggccaaggacggccaggacctg
cgtttccataacaacacgcgctttctgctcagcaacctgctgattgactcggcaggcgag
ggcgactctgggacgtatgcgtgtcacgctgacaacggcatcggatcggagagcgccgct
acagtgctgtatgacgtgctggtgtttgagcccccccaggtgaccgtagaggtccagcaa
caggaggtgatgtggggggagaacgtacgcttcagctgccaggccaggggtaaacccacc
ccctctgtcgtatggctccacaacgcccgccccctggccacgtcgccacgccaccgcctg
tctgcccgcgtgctgcgtgtcatcaacgtgggcccacaggacgatggcctgtaccagtgc
atggctgagaacggcgtgggcagctcgcaggccgctgccagactggtcaccttgccaacc
agtaacccgtcgcggtcagggaagctgccgtccaacctgcgtcccctgagcccagacaag
gtgctgtgggagcaggtgccagtgaagcccggggccacgggtagcgtgctgaccctggac
tgctctgggctaactgggcagatctctgtggcagaggcccctgtcattctcagccagccc
agaaccgtcaaggccgacttctatgatctgacctggaaacctcgccacgatggaggctct
gctgtggtggagtacatcgtcaagtacagaaagattgaggaccctccaggtgagtggacc
agcagctgtatatctgggtctctccacaagctgaccctggccaagctgcagccagccagt
ctgtacgaggtggagatgtctgctaagaactgtgctggcctgggacaaccggccatgatg
accttcaggacaggcaaaggacgtaggggtccagggggacagaacgagccccctaaaaca
cctgcagtaccatcacctcgcctctctcctcccgaggcccctgataagcccaccatctcc
acggcgacagagacgtctgcgtacgtaacgtggatcccgcgcggtaaccgtggtttcccc
atccagtcattccgggtggagtttaagaagctgaaagggaagggagggggggaatgggag
gtggctgtcactaatatccccccccaacgactgtctgtggagatcactggcctggagaaa
ggcatgtcttataagttccgtgtgttggcggtgaatgtgattggcgccagcccccccagt
gtcccctctaaggcctacacggtgttgggtggcggcaggcccaacgaacgccctgtagac
ggaccctacatcacttataatgaagccatcaacgagaccaccatcatcctcaaatggacg
tacactgccgtcaacaacacccctgtctacggtttctacatcttctaccggccgacagac
agtgacaacgacagtgactataagaaggatgtggtggagggtgatcgctactggcactct
atcactgacctgcagcctgagacggcctacgacatcaagatgcagagcttcaacgagggg
ggagagagcgagtttggtaacgtggttatcttagaaactaaagctcgtctgaaccagcgg
ccctccccgccggagacgtggtcccagagaccagagcactccggggggcctgcgccccgc
cccagcgacctcccctacctcatagtgggcgtggtcctgggggccctcgtgttcatcatc
gtagccttcatccccttctgcctgtggagagcctgggccaaagagaaggaaatgtcagac
ctgtgtttcccagctgtggcgtcccctgtctcctcctgccagtacaccatggtgcccctg
cagggcctggcactggtcgggcattgccccctggacccccacttgcccccaccgcacgcc
gtctacccacccatcggactgtacacctccaacgggaaacaccatcgacccacacactgc
ctgccaggactacatcaggaggatgtggagtatgatatggagtgtggcacgctactagca
cagaccatgtcaaacggacacgtcccagtctaccactactctaacagtgagcctgagcat
catggagacagagaagatcactgctttctgcccgatgactccaccctccagctactcaac
acctcagaacagccaatcagcagtcaggacctgacggggaacgcccgtttttacaatggg
gatatcataagggagaaggacatcaatcaagtcccctctgtctgtgtagacctaccctgc
tctccctgtcctctgctatcactggaggaggagaactccaaggcgacaacctcagcagct
acaacggcagaatcccaagatgcacttccactccaggaagtgaacaccctccagagtgaa
acgccaccggtagaacaagggacgtcagattaa

KEGG   Salmo salar (Atlantic salmon): 106594537
Entry
106594537         CDS       T04363                                 

Definition
(RefSeq) growth arrest-specific protein 1-like
  KO
K06232  growth arrest-specific 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106594537
SSDB
Motif
Pfam: GDNF
Other DBs
NCBI-GeneID: 106594537
NCBI-ProteinID: XP_014041379
UniProt: A0A1S3QPQ8
LinkDB
Position
Un
AA seq 249 aa
MKSWCSALALFSSVLLVLDAQLICWQALLRCHEEADCELAYSQYLAACEGNIRGTRRQCP
SHCINALIRLNHTRNGPYLERCDCGQDMECRDAKRAIEPCLPRRYRGDAGGIGCTEARQR
CEEDTGCHSSLTAYLSYCGQLFNGRKCSSRCKATIQQMLFIPNGMLLNQCVCDGVERPFC
EVVKENMSKLCQIGDHSVISDQADMDDMYEDEDYDSKTEEIYPPDSNSSSPQLSSYMALL
CITLTRIFY
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaaaagttggtgcagcgctctggcgctcttctcatcggtgctgttggtgctagatgcc
cagttaatatgttggcaagccctgctccgatgccatgaggaggcagactgtgagcttgca
tatagccagtatctagccgcctgtgaaggaaacattagaggcaccaggaggcaatgcccc
agccactgtatcaacgcgttgataagactgaatcacacccgcaatggcccttacctcgag
aggtgtgactgtggtcaggacatggagtgtagggatgcaaagcgggcgattgagccatgc
ctcccccggaggtatcgtggagacgcgggggggataggatgcacagaggcccgtcaacgc
tgcgaggaggacaccggctgccactcctccttgacagcctacttgtcttactgtgggcaa
ctcttcaatggcaggaaatgttcgtccaggtgcaaggccacaatacaacagatgctattc
atcccaaatggcatgctactaaaccagtgtgtgtgcgacggggtggaaaggccgttctgt
gaggtagtcaaggagaacatgagcaaactgtgccagattggagaccacagtgttatttca
gaccaggcagatatggacgatatgtatgaggatgaagactatgattcgaaaacagaggag
atatatcctcctgactcaaattctagttccccgcagctgtcgagctatatggccttatta
tgcatcactcttacacggatattctattga

DBGET integrated database retrieval system