KEGG   Salmo salar (Atlantic salmon): 106561972
Entry
106561972         CDS       T04363                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX-like
  KO
K02159  apoptosis regulator BAX
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106561972 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106561972 (BAX)
   04217 Necroptosis
    106561972 (BAX)
   04115 p53 signaling pathway
    106561972 (BAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106561972 (BAX)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106561972 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sasa03029]
    106561972 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sasa02000]
    106561972 (BAX)
Mitochondrial biogenesis [BR:sasa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    106561972 (BAX)
Transporters [BR:sasa02000]
 Other transporters
  Pores ion channels [TC:1]
   106561972 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 106561972
NCBI-ProteinID: XP_013981944
UniProt: B5XC79
LinkDB
Position
ssa11
AA seq 204 aa
MADSRERRKTGEDEPQGAVGGEDVIDDRIMEQGAVVLRGYVIERVSAENPERRLAPEDLG
GRPNEQEDHQVKDVVHQLLLIADDLNRNAELQHLISTVQVNCAQDVFFSVAREIFADGIN
WGRVVTLFHLAYKLIYKALTQNHLEIIKKVISWVLQFIRENVSAWIRQQGGWEAAVSTVS
HWRTVSLVAAVAFVTAMVYWRKTR
NT seq 615 nt   +upstreamnt  +downstreamnt
atggcagactcccgagaaagaaggaaaaccggcgaagatgagcctcagggtgcagtcggg
ggtgaagatgtcatcgacgacagaattatggaacaaggagctgttgttttaagagggtat
gtcatcgagagggtcagtgcagaaaacccagagaggcgtttggctccagaggaccttggt
ggcagacccaacgaacaagaggaccaccaagtcaaagacgtggtacaccagctgctgctg
atcgctgatgacctgaacagaaatgctgagctacaacacctaataagcacagtccaggtg
aactgtgcccaggatgtgttcttctcagtggccagggaaatctttgcagatggtatcaac
tggggcagagtggtcacactgtttcacttggcctacaagcttatttacaaggcactgaca
cagaaccacttagaaatcatcaagaaggttattagctgggtattacagttcatcagggaa
aatgtctccgcttggatccgacagcaaggaggatgggaggcggctgttagcaccgtgtca
cattggcgtactgtgtcacttgtggctgcagtggctttcgtgacggccatggtttactgg
aggaaaacacgctga

KEGG   Salmo salar (Atlantic salmon): 106583949
Entry
106583949         CDS       T04363                                 

Definition
(RefSeq) apoptosis regulator BAX-like
  KO
K02159  apoptosis regulator BAX
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106583949
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106583949
   04217 Necroptosis
    106583949
   04115 p53 signaling pathway
    106583949
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106583949
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106583949
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sasa03029]
    106583949
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sasa02000]
    106583949
Mitochondrial biogenesis [BR:sasa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    106583949
Transporters [BR:sasa02000]
 Other transporters
  Pores ion channels [TC:1]
   106583949
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 106583949
NCBI-ProteinID: XP_014024131
UniProt: A0A1S3P972
LinkDB
Position
ssa23
AA seq 204 aa
MACVETSDDRVGEVLLKRVMQEQLDEVLSSEVPVVVSTETQELESEQEQKMVLQLAVMIR
TIGDAFKENRELDDNSVIDGMVGQMTSKPSYWKLVEKVFEDGQITWERIAVLFYVAGRIA
VKVVIANLPELVKDILKWTLEYFRGKLLDWIQKHGGWMNSFAELARVQVERISSMSARSS
GLILVFLGGVIMGSVITWKLARRT
NT seq 615 nt   +upstreamnt  +downstreamnt
atggcgtgtgtagagacatcagatgacagagtaggagaggtcctgctgaaaagagtgatg
caggagcagctggatgaggtgttgtcatcagaagtcccggtagtggtctccacagaaacc
caggaattggagagtgagcaggagcagaagatggtgttacagctggctgtgatgatacgt
accatcggagacgccttcaaggagaacagggagctggacgacaacagtgtgatagatgga
atggtggggcaaatgaccagcaagcccagctactggaagttggtagaaaaggtatttgag
gacggtcaaatcacctgggagagaattgctgtgctgttctacgtagcagggaggatagct
gtcaaggtggtgattgctaacctccccgagttagtgaaggacattctgaagtggactctg
gagtacttcagaggcaaattactggactggatccagaaacatggaggatggatgaacagt
ttcgctgagctggcacgtgtacaggtggagaggatatcctctatgagcgcccggtcctca
gggctcatcctggtcttcctcggaggtgtcataatgggtagtgttatcacctggaaactg
gccaggaggacctga

KEGG   Salmo salar (Atlantic salmon): 106587134
Entry
106587134         CDS       T04363                                 

Gene name
BAX
Definition
(RefSeq) apoptosis regulator BAX-like
  KO
K02159  apoptosis regulator BAX
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106587134 (BAX)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106587134 (BAX)
   04217 Necroptosis
    106587134 (BAX)
   04115 p53 signaling pathway
    106587134 (BAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106587134 (BAX)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106587134 (BAX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sasa03029]
    106587134 (BAX)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sasa02000]
    106587134 (BAX)
Mitochondrial biogenesis [BR:sasa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    106587134 (BAX)
Transporters [BR:sasa02000]
 Other transporters
  Pores ion channels [TC:1]
   106587134 (BAX)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 106587134
NCBI-ProteinID: XP_014030655
UniProt: E0R7W0
LinkDB
Position
ssa26
AA seq 204 aa
MADSRERRKTGEDEPQGAFGGEDVNDDRIMEQGAIVLRGYVIERISAENPARHLAPEDLG
GRPNEQEDHQVKDVVHQLLLIADDLNRNAELQHLISRVQVNCAQDVFFSVAREIFADGIN
WGRVVSLFHLAYKLIYKALTQNHLEIIKKVISWVLQFIRENVSAWIRQQGGWEAVVSTVS
HWRTVSLVAAVAFVAVMVYWRKTR
NT seq 615 nt   +upstreamnt  +downstreamnt
atggcagactcccgagaaagaaggaaaactggcgaagatgagcctcagggtgcattcggg
ggtgaagatgtcaacgacgacagaattatggaacaaggagctattgttttaagagggtat
gtcatagagaggatcagtgcagaaaacccagcgaggcatttggctccagaggaccttggt
ggcagacccaacgaacaagaggaccaccaagtcaaagacgtggtacaccagctgctgctg
atcgctgatgacctgaacagaaatgctgagctacaacacctaataagcagagtccaggta
aactgtgcccaggatgtgttcttctcagtggccagggaaatctttgcagatggtatcaac
tggggcagagtggtctccctgtttcacttggcctacaagcttatttacaaggcactgaca
cagaaccacttagaaatcatcaagaaggttattagctgggtattacagttcatcagggaa
aatgtctccgcttggatccgacagcaaggaggatgggaggcggttgttagcactgtgtca
cattggcgtacggtgtcgcttgtggctgcagtggctttcgtggcggtcatggtttactgg
aggaaaacacgctga

KEGG   Salmo salar (Atlantic salmon): 106600761
Entry
106600761         CDS       T04363                                 

Definition
(RefSeq) apoptosis regulator BAX-like
  KO
K02159  apoptosis regulator BAX
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106600761
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106600761
   04217 Necroptosis
    106600761
   04115 p53 signaling pathway
    106600761
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106600761
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106600761
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sasa03029]
    106600761
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sasa02000]
    106600761
Mitochondrial biogenesis [BR:sasa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    106600761
Transporters [BR:sasa02000]
 Other transporters
  Pores ion channels [TC:1]
   106600761
SSDB
Motif
Pfam: Bcl-2 BID DUF3912
Other DBs
NCBI-GeneID: 106600761
NCBI-ProteinID: XP_014047851
UniProt: A0A1S3R6U6
LinkDB
Position
ssa03
AA seq 205 aa
MACVETSDYRVGEVLLNRVMQEQLDEVSSDIPVVVSTETQEVESDQEQKIVSQLAMMIRT
IGDAVKKDGKLDDAIDGMVGKMTSKTSYWKLVEKVFEDSQITWERIAVLFYVAGRIAVKV
VIAHIPQLVKDILKWTLEYFRNKLLDWIQKHGGWMNSFAELARVQVEKMSSMNTWSSGFI
LVFLGGVILGKWHGCTQCLIRLAAM
NT seq 618 nt   +upstreamnt  +downstreamnt
atggcgtgtgtagagacatcagattacagagtaggagaggtcctgctgaatagagtgatg
caggagcagctggatgaggtgtcatcagacatcccggtagtggtctccacagaaacccag
gaggtggagagtgatcaggagcagaagattgtgtcacagctagctatgatgatacggacc
atcggagacgccgtcaagaaggacgggaagctggacgatgcgatagatggaatggtgggg
aaaatgaccagcaagaccagctactggaagttggtagaaaaggtatttgaggacagtcaa
atcacctgggagagaattgctgtgctgttttacgtagcagggaggatagctgtcaaggtg
gtgattgctcacatcccccagttagtgaaggacattctgaagtggactctggagtacttc
agaaacaaattactggattggatccagaaacatggaggatggatgaacagttttgctgag
ctggcacgtgtgcaggtggagaagatgtcctctatgaacacctggtcctcagggttcatc
ctggtcttcctcggaggtgtcatactgggaaagtggcatggctgcacccagtgccttatt
cgcttagcggcgatgtag

KEGG   Salmo salar (Atlantic salmon): 106601126
Entry
106601126         CDS       T04363                                 

Definition
(RefSeq) apoptosis regulator BAX-like
  KO
K02159  apoptosis regulator BAX
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106601126
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106601126
   04217 Necroptosis
    106601126
   04115 p53 signaling pathway
    106601126
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106601126
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106601126
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sasa03029]
    106601126
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sasa02000]
    106601126
Mitochondrial biogenesis [BR:sasa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    106601126
Transporters [BR:sasa02000]
 Other transporters
  Pores ion channels [TC:1]
   106601126
SSDB
Motif
Pfam: Bcl-2 DUF997
Other DBs
NCBI-GeneID: 106601126
NCBI-ProteinID: XP_014048550
UniProt: A0A1S3R861
LinkDB
Position
ssa03
AA seq 194 aa
MATPSGGGDSGNGTDQVLELGKRLLTDFIYERVRRHADSSTQLSVSRTQLGGSELCDHNE
KKLAHCLQQIGDELDSNTQLQSMINDTALQPSQEVFMRVACEIFSDGKFNWGRVVALFYF
ACRLVIKALLTKVPDIIRTIISWATDYLRDHVINWIREQGGWEGIRSYFGTPTWQTVGVF
LAGVLTTVLVIRRM
NT seq 585 nt   +upstreamnt  +downstreamnt
atggctacgccgtcgggaggaggcgattcaggtaatggaactgatcaggtactagaactg
ggaaaaagattactgacagatttcatctacgagcgggttcgtcgccatgctgacagcagt
actcagttgtcagtgtcacggacccagttgggcgggagtgagctgtgtgaccacaacgaa
aagaaactggcccactgcctacagcaaattggagatgagctggatagcaatacacaactc
caaagtatgataaatgatactgcactccagcccagccaggaggtttttatgagagtggcc
tgtgagatcttctctgatgggaagttcaactggggcagggtggtggcactcttctacttt
gcctgtcggctggtcatcaaggctctgttgaccaaggtccccgacatcatcagaaccatt
atcagctgggccacagactacctgcgagatcatgtgatcaactggattagggagcagggt
ggctgggagggaatccgttcctactttggcactcccacctggcagaccgtgggtgtgttc
ctcgctggagttcttaccactgtgctggtcatccgcaggatgtga

KEGG   Salmo salar (Atlantic salmon): 106607327
Entry
106607327         CDS       T04363                                 

Definition
(RefSeq) apoptosis regulator BAX-like
  KO
K02159  apoptosis regulator BAX
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106607327
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106607327
   04217 Necroptosis
    106607327
   04115 p53 signaling pathway
    106607327
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106607327
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106607327
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sasa03029]
    106607327
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sasa02000]
    106607327
Mitochondrial biogenesis [BR:sasa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    106607327
Transporters [BR:sasa02000]
 Other transporters
  Pores ion channels [TC:1]
   106607327
SSDB
Motif
Pfam: Bcl-2 DUF997
Other DBs
NCBI-GeneID: 106607327
NCBI-ProteinID: XP_014059662
UniProt: A0A1S3S5P7
LinkDB
Position
ssa06
AA seq 194 aa
MAAPSGGGDSGNGTDQVLELGEKLLTDFIYERVRHHADSSTQLSVSRTQLGGSELCDPNH
KKLALCLQQIGDELDGNTQLQSMLNDTALQPSHEVFMRVAREIFSDGKFNWGRVVALFYF
ACRLVIKALLTKVPDIIRTIISWATDYLRDHVINWIRDQGGWEGIRSYFGTPTWQTVGVF
LAGVLTTVLVIRKM
NT seq 585 nt   +upstreamnt  +downstreamnt
atggcagcgccgtcgggaggaggcgattcaggtaatggaactgatcaggtactagaactg
ggggaaaaattactgacagatttcatctacgagcgagttcgtcaccatgctgacagcagt
actcagttgtcagtgtcacggacccagttgggcgggagtgagctgtgtgaccccaaccac
aagaaactggccctgtgcctgcagcagattggagatgagctggatggcaatacgcagctc
caaagtatgttaaatgatactgcactccagcccagccatgaggtttttatgagagtggcc
cgtgagatcttctctgatggaaagttcaactggggcagggtggtggcactcttctacttt
gcctgtcggctggtcatcaaggctctgttgaccaaggtccctgacattatcagaaccatt
atcagctgggctacagactacctgcgagatcatgtgatcaactggattagggatcagggt
ggctgggagggaatccgttcctactttggcactcccacctggcagaccgtgggggtgttc
ctcgctggagttcttaccactgtgctggtcatccgcaagatgtga

KEGG   Salmo salar (Atlantic salmon): 106607328
Entry
106607328         CDS       T04363                                 

Definition
(RefSeq) apoptosis regulator BAX-like
  KO
K02159  apoptosis regulator BAX
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04115  p53 signaling pathway
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa05132  Salmonella infection
sasa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106607328
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106607328
   04217 Necroptosis
    106607328
   04115 p53 signaling pathway
    106607328
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106607328
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    106607328
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sasa03029]
    106607328
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sasa02000]
    106607328
Mitochondrial biogenesis [BR:sasa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    106607328
Transporters [BR:sasa02000]
 Other transporters
  Pores ion channels [TC:1]
   106607328
SSDB
Motif
Pfam: Bcl-2 DUF997
Other DBs
NCBI-GeneID: 106607328
NCBI-ProteinID: XP_014059663
UniProt: A0A1S3S5P6
LinkDB
Position
ssa06
AA seq 194 aa
MAAPSGGGDSGNGTDQVLELGEELLTDLIYERVRHHADSRTRLSMSRTQLIGSELCDPNH
KKLVLCLEQIGNELDGNTQLQSMLNDTALQPSHEVFMRVAREIFSDGKFNWGRVVALFYF
ACRLVIKALLTKVPDIIRTIISWATDYLRDHVINWIRDQGGWEGIRSYFGTPTWQTVGVF
LAGVLTTVLVIRKM
NT seq 585 nt   +upstreamnt  +downstreamnt
atggcagcgccgtcgggaggaggcgattcaggtaatggaactgatcaggtactagaactg
ggggaagaattactgacagatttaatctacgagcgggttcgtcaccatgctgacagcagg
actcggttgtcaatgtcacggacccagttgattgggagtgagctgtgtgaccccaaccac
aagaagctggtcctgtgcctggagcagattggaaatgagctggatggcaatacgcagctc
caaagtatgttaaatgatactgcactccagcccagccatgaggtttttatgagagtggcc
cgtgagatcttctctgatggaaagttcaactggggcagggtggtggcactcttctacttt
gcctgtcggctggtcatcaaggctctgttgaccaaggtccctgacatcatcagaaccatt
atcagctgggctacagactacctgcgagatcatgtgatcaactggattagggatcagggt
ggctgggagggaattcgttcctactttggcactcccacctggcagaccgtgggggtgttc
ctcgctggagttcttaccactgtgctagtcatccgcaagatgtga

DBGET integrated database retrieval system