KEGG   Salmo salar (Atlantic salmon): 106562137
Entry
106562137         CDS       T04363                                 

Definition
(RefSeq) G2/mitotic-specific cyclin-B1-like
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04114  Oocyte meiosis
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106562137
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106562137
   04114 Oocyte meiosis
    106562137
   04115 p53 signaling pathway
    106562137
   04218 Cellular senescence
    106562137
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    106562137
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sasa03032]
    106562137
   03036 Chromosome and associated proteins [BR:sasa03036]
    106562137
DNA replication proteins [BR:sasa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    106562137
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    106562137
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 106562137
NCBI-ProteinID: XP_013982244
UniProt: A0A1S3KU66
LinkDB
Position
ssa11
AA seq 427 aa
MPYNLRSKLPVKVTNPTYQEKFAVPKVKVQTKSEENVSLPGKPVISYGLRSRVPLGNVAS
KLNNAKGIKTNTAVHVKPAQRKQSTTERVHVISKENTGAGNCDLVRQAKHIPAAPEEPPS
QEATRDEGLNVPQAFSHALLNIPDVDSADAGNSSLCSDYVKDIYAHLRNLEVAMAIKPCY
LEGCDVTGSMRSILVDYLVQVQKQFRLHQETLYMTVGIIDRFLQDYPVPKKSLQLVGVTA
MLIASKYEEIAPPVVKDFAHITDFTYSCAEICLMEMTILKALNYELGRPPPVHFLRRAAK
VGKPQPVGYGLAKYLLELTLLDYASVHYPPSLTAAAALALSSSILHDSAGYEWTPALQHY
TGYTEVSLLPVMQCIAKMLERLSDGSMKQLSIKQKYDNVKLLRVSCLPELTSTRAYAYIN
KLSNSHC
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgccttacaacttgaggtccaaattgcctgtgaaggtaaccaatcctacctatcaggaa
aaatttgcagttccaaaggtgaaggtccagaccaagtcagaggagaatgtttccttacca
ggaaaacctgtcatctcatatggcctgaggtccagggtgcctttgggaaatgtagcaagc
aaactgaacaacgccaaagggattaaaacaaatacggctgttcacgtcaaaccagctcaa
cgtaagcagagcaccactgaaagagtccatgttatttcgaaggagaacactggggctggc
aactgtgatctggtcagacaggccaagcacattccagctgcccctgaggagcctcccagc
caagaggccactcgggatgaggggctcaatgtgccacaggccttctcacatgccctgctc
aacatcccagatgtggactctgcagacgcgggcaactcctcgctgtgcagtgactatgtg
aaggacatttacgctcatctaaggaacctggaggttgccatggctataaaaccatgttat
ctggagggttgtgatgtgactgggagcatgcggagtattctagttgactacctggtacag
gtccagaagcagttcagactgcaccaggagactctctacatgactgttgggatcatcgac
cgctttctccaggactatccagtgccaaagaagtctctgcaactggttggtgtcactgcg
atgctcatcgcttccaagtacgaggaaatcgctcctcccgtggtcaaggactttgcccat
ataacagacttcacctactcctgtgctgagatatgcttgatggaaatgaccattctgaaa
gccttgaactatgaactgggacgaccaccaccagttcactttctaaggagagccgccaag
gttgggaagcctcagcctgttggttatgggctggctaaatacctgctggagctgaccctt
ctggactatgcctcagttcactatccaccatccctgacagctgcagcagctcttgcttta
tcatccagtatccttcatgattctgctggttatgaatggaccccagccctgcagcactac
acgggctacacagaggtctctctgctacctgtgatgcaatgcattgccaagatgctggag
cgcttgagtgatggcagcatgaaacagttgtcaatcaagcagaagtatgacaacgtcaag
ctactcagggtcagctgtctcccagagctgacatctaccagggcttatgcctatattaac
aaactgtccaactctcactgttga

KEGG   Salmo salar (Atlantic salmon): 106563318
Entry
106563318         CDS       T04363                                 

Gene name
ccnb1
Definition
(RefSeq) cyclin B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04114  Oocyte meiosis
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106563318 (ccnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106563318 (ccnb1)
   04114 Oocyte meiosis
    106563318 (ccnb1)
   04115 p53 signaling pathway
    106563318 (ccnb1)
   04218 Cellular senescence
    106563318 (ccnb1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    106563318 (ccnb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sasa03032]
    106563318 (ccnb1)
   03036 Chromosome and associated proteins [BR:sasa03036]
    106563318 (ccnb1)
DNA replication proteins [BR:sasa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    106563318 (ccnb1)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    106563318 (ccnb1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 106563318
NCBI-ProteinID: XP_013984298
UniProt: B5X5H0
LinkDB
Position
ssa11
AA seq 399 aa
MALPMTRSRLASSENQTTLPGKAVLGTKPTLRQRAALGEIGNVGVPRQTLKKNAKAETTK
VVDRKTNTRAEKAQVVQQPKIVVFAPVQVLPEPMSPTPMETSGCAPNELCQAFSDVLLNI
KDVDADDYDNPMLCSDYVKDIYKYLQKLEIDQAVKPKYLEGQEITGNMRAILIDWLVQVQ
IKFRLLQETMFMTVGIIDRFLQDNPVPKKQLQLVGVTAMFIASKYEEMYPPEIVDFAFVT
DQAYTTAQIRDMEMKILRVLKFSFGRPLPLQFLRRASKIGEVTAEHHTLAKYFVELTMVD
YEMVHFPPSQVASAAFALTLKVFNCGEWSSTLQHYMNYTEDSLVPAMQHIAKNVLKVNEG
QTKHMTVKNKYSSQKQMRIATISQLKSSLIKDLAKQLAL
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggctctccctatgaccagaagtcgcctggcttcctcagagaaccaaactactctgccg
ggcaaggctgttctgggaaccaagcctacattgagacaacgagctgcgctcggcgaaatc
ggaaatgttggagtccccagacagactctgaaaaagaatgcaaaggcagaaaccacaaag
gtggttgacaggaagaccaacacacgggctgaaaaggcacaggtggttcaacaaccaaaa
atcgtagtttttgcccctgttcaggttttgcctgagccaatgtctcccacaccaatggag
acctctggctgtgctcccaacgagctgtgccaggccttctcagatgtcctacttaatatc
aaggatgtcgacgctgacgactacgacaatcccatgctctgcagtgactatgtgaaggac
atctacaaatatctccagaaacttgagatcgatcaggctgtcaaacccaaatatctggag
ggacaggaaattacaggcaacatgcgtgctatcctcatcgattggctcgtccaggtccaa
ataaagttccgcctgctgcaggagaccatgttcatgactgtgggaatcattgatcgcttc
cttcaggataacccagtgcccaaaaagcagctccagcttgttggtgtgacagccatgttc
attgcttccaaatacgaggagatgtaccctccggagatcgtagactttgcctttgttacc
gaccaggcctacaccactgcacaaatcagggacatggagatgaagatcctaagggtgctg
aagttcagctttggccgccctctccccctccagttcctcagaagggcctcaaagattggc
gaggtgactgctgagcaccacaccctggcaaagtactttgtggagctcaccatggtcgat
tacgagatggtgcacttccctccctcgcaggtggccagtgcagcctttgccctcaccctg
aaggtcttcaactgcggtgaatggagctccacactacagcattacatgaactacacagaa
gacagcctggtccctgccatgcagcatatcgctaaaaatgttctgaaggtgaacgaggga
caaactaagcatatgacggttaagaacaagtactctagtcagaagcagatgagaattgcc
actatttcacagctgaagtcttcgctgatcaaggaccttgcaaaacaactcgccctatga

KEGG   Salmo salar (Atlantic salmon): 106566708
Entry
106566708         CDS       T04363                                 

Gene name
CCNB1
Definition
(RefSeq) G2/mitotic-specific cyclin-B1-like
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04114  Oocyte meiosis
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106566708 (CCNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106566708 (CCNB1)
   04114 Oocyte meiosis
    106566708 (CCNB1)
   04115 p53 signaling pathway
    106566708 (CCNB1)
   04218 Cellular senescence
    106566708 (CCNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    106566708 (CCNB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sasa03032]
    106566708 (CCNB1)
   03036 Chromosome and associated proteins [BR:sasa03036]
    106566708 (CCNB1)
DNA replication proteins [BR:sasa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    106566708 (CCNB1)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    106566708 (CCNB1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 106566708
NCBI-ProteinID: XP_013990494
UniProt: B5XCM8
LinkDB
Position
ssa01
AA seq 403 aa
MAHRMTRNRLGSSENQTALPGKVVLGTKPTLRARAALGEIGNVGVPRQTLKKDAKAEPTK
VVERKASTRLAKVPEVQQPQKVAIAPVKLEVQVLPEPMSPTAMETSGCAPIELCQAFSDV
LLSIKDVDADDYDNPMLCSEYVKDIYKYLQKLEVDQAVKPKYLEGQEITGNMRAILIDWL
VQVQIKFRLLQETMYMTVGIIDRFLQDNPVPKKQLQLVGVTAMFIASKYEEMYPPEIADF
AFVTDRAYTTAQIRDMEMTILRVLKFSFGRPLPLQFLRRASKIGEVTAEHHTLAKYLVEL
TMVDYEMVHFPPSQVASAAFALTLKVFNCGDWSSTLQHYMNYTEDCLVPVMQHIAKNVVK
VNEGQTKHMAVKNKYSSQKHMKIATISQLKSLLIKDLAKQLTL
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggctcaccgtatgactagaaatcgtctgggttcctcagagaaccaaactgctctgcca
ggcaaggtagttctgggaaccaagcctacactgagagcaagagctgcgctcggcgaaatc
ggaaatgttggagtccccagacagactctgaaaaaggatgccaaggcagaacccacaaag
gtggttgagaggaaggccagcacacggctggcgaaggtccctgaggtccaacaaccccaa
aaagttgctattgcccctgttaagttggaggttcaggttttacctgagccaatgtctccc
acagcaatggagacctctggctgtgctcccattgaactgtgccaggccttctctgatgtc
ctacttagtattaaggatgtggatgctgatgactacgacaaccccatgctctgcagtgaa
tatgtgaaggacatctacaaataccttcagaaacttgaggttgatcaggctgttaaaccc
aaatatctggaaggacaggaaattacaggcaacatgcgtgctattctcatcgattggctt
gtccaggtccaaatcaagttccgcctgctgcaggagaccatgtatatgactgtgggaatc
attgaccgcttccttcaggataacccagtgcccaaaaagcaacttcagttggttggtgtg
actgcgatgttcatcgcctccaaatacgaggagatgtaccctccagagattgcagacttt
gcatttgtgaccgaccgggcctacaccactgcccagatcagggacatggaaatgacgata
ctgagagtgctgaagttcagctttggccgccctctccccctccagttcctcagaagggcc
tcaaagattggcgaggtgactgctgagcaccacaccctggcaaagtacttggtggagctc
accatggtggactatgagatggtgcacttccctccctcccaggtggctagtgctgccttc
gccctcaccctgaaggtcttcaactgtggtgactggagttccacactgcagcattacatg
aactacaccgaagactgcttagtcccggtcatgcagcacatagcaaaaaatgttgtgaag
gtgaacgagggacaaactaagcatatggcagttaagaataagtactctagtcagaagcat
atgaagatcgccaccatttcacagctgaaatctttgctgatcaaggaccttgcaaagcag
ctcaccctatga

KEGG   Salmo salar (Atlantic salmon): 106587173
Entry
106587173         CDS       T04363                                 

Definition
(RefSeq) G2/mitotic-specific cyclin-B1-like
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04114  Oocyte meiosis
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106587173
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106587173
   04114 Oocyte meiosis
    106587173
   04115 p53 signaling pathway
    106587173
   04218 Cellular senescence
    106587173
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    106587173
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sasa03032]
    106587173
   03036 Chromosome and associated proteins [BR:sasa03036]
    106587173
DNA replication proteins [BR:sasa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    106587173
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    106587173
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 106587173
NCBI-ProteinID: XP_014030727
UniProt: A0A1S3PSR3
LinkDB
Position
ssa26
AA seq 197 aa
MRTRRALGLATVIWSDRPSPFQLPLRSLRAMRPLGSRGSMCHRPSHMPYSTSQMWTLHMQ
VAMAINPIWRDVTGSVWRILIDWLVHGQRQFRLHQQTLYITVGIIDRFLQNYPVPKKSLQ
LVGVTAMLIASKYEEIAPPMVEDFAHATDFTYSCAEIRLMEITILKALNYELGRPPPVHF
LRRAAKVEASACWLWAG
NT seq 594 nt   +upstreamnt  +downstreamnt
atgaggacaaggagagcactggggctggcaactgtgatctggtcagacaggccaagccca
ttccagctgcccctgaggagcctcagagccatgaggccacttgggtccaggggctcaatg
tgccacaggccttctcacatgccctactcaacatcccagatgtggactctgcacatgcag
gttgccatggctatcaaccccatctggagggatgtgactgggagcgtgtggcgtattcta
attgactggctggtacatggccagaggcagttcagactgcaccagcagaccctctacata
actgttgggatcattgaccgctttctccagaactatccagtgccaaagaagtctctgcaa
ctggttggtgtcactgcgatgctcatcgcttccaagtacgaggaaatcgctcctcccatg
gtggaggactttgcccatgcaacagacttcacatattcctgtgctgagatacgcttgatg
gaaattaccattctgaaagccttgaactatgaactgggacgaccaccaccagttcacttt
ctaaggagagccgccaaggttgaagcttcagcctgttggttatgggctggctaa

KEGG   Salmo salar (Atlantic salmon): 106587338
Entry
106587338         CDS       T04363                                 

Gene name
ccnb2
Definition
(RefSeq) cyclin B2
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04068  FoxO signaling pathway
sasa04110  Cell cycle
sasa04114  Oocyte meiosis
sasa04115  p53 signaling pathway
sasa04218  Cellular senescence
sasa04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106587338 (ccnb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106587338 (ccnb2)
   04114 Oocyte meiosis
    106587338 (ccnb2)
   04115 p53 signaling pathway
    106587338 (ccnb2)
   04218 Cellular senescence
    106587338 (ccnb2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    106587338 (ccnb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sasa03032]
    106587338 (ccnb2)
   03036 Chromosome and associated proteins [BR:sasa03036]
    106587338 (ccnb2)
DNA replication proteins [BR:sasa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    106587338 (ccnb2)
Chromosome and associated proteins [BR:sasa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    106587338 (ccnb2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cluap1
Other DBs
NCBI-GeneID: 106587338
NCBI-ProteinID: XP_014031121
UniProt: A0A1S3PTY2
LinkDB
Position
ssa26
AA seq 390 aa
MSSLEVRAALKNADNPALMGKANVAGARRAVLGELSNFPNASKAVPSKKTVAAKSSTKQS
MNQKDQPAAVRPKRSPVAQVPQPEESANVSMKEEELCQAFSVTLLAVEDIDEGDSDMPQL
CSEYIKDIYRYLQRLETQQSVRPKYMNGYEINGRMRALLIDWLVQVHSRFQLLQETLYLT
VAILDRFLQVQTIGRKKLQLVGVTAMLLASKYEEMYSPEIGDFVYITDNAFTKAHIREME
QLILQSLNFELGRPLPLHFLRRASKAGNADVEKHTLAKYLMELTLLDYDMVHYHPSEIAA
AALCLSQLLLDELNWTPTQAHYSTYNENHLKPIMQHIAKNVVSVNEGRTKLQAVKNKYAS
SRLMRISLIPQLKSAVVNDMAAALLPEHKP
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgtcttcattagaagttcgtgctgcgttaaagaacgcagacaacccagcactaatgggg
aaagcaaacgtagctggagcaagaagggctgtgcttggagagctgtccaactttcccaat
gccagcaaagcggtgccgtccaagaagactgttgctgctaagtcttcaaccaaacaatct
atgaaccaaaaagatcagccagcagctgttcggcctaaacgttccccagtggctcaagtt
cctcagcctgaagagtctgctaacgtgtccatgaaagaagaggaattgtgtcaggcgttc
tcagtaactctacttgctgtagaagacattgacgaaggggattcagacatgccacaacta
tgctctgaatatataaaggatatctatcgatatttgcagcgccttgagacccagcagtct
gtccggccgaagtacatgaatggctatgagatcaatggacgcatgcgcgctctcctgatt
gactggctggttcaggtgcactccaggttccagctactgcaggagactctgtatttgact
gtggccatcctggatcgctttcttcaggtgcaaactattggccgcaagaagctccagctg
gttggggtgactgccatgttgttggcttccaagtatgaagagatgtattccccagagatt
ggtgatttcgtttacatcacagacaatgcattcaccaaggctcatattcgggagatggaa
cagctgattctgcagagtctgaactttgagcttggacggcctctacccctacacttcctc
aggagagcctccaaggctggcaatgctgatgttgagaagcacacactagccaaatacctc
atggaactgaccctccttgactatgacatggtgcactaccatccttctgagattgcagct
gctgccttgtgcctctcccagctgctgcttgatgagctcaactggactccaacacaggcg
cattactctacctataacgagaaccacctcaagccaatcatgcagcacatcgccaaaaat
gttgtctctgtcaatgaagggcgaacaaagcttcaggctgtcaagaataagtatgcaagc
agcaggctaatgaggatcagcctcatccctcagctgaagtctgctgttgtaaatgacatg
gctgctgctctgctcccagaacataaaccctga

DBGET integrated database retrieval system