KEGG   Salmo salar (Atlantic salmon): 106562252
Entry
106562252         CDS       T04363                                 

Definition
(RefSeq) kinesin-like protein kif7
  KO
K18806  kinesin family member 7
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106562252
Cytoskeleton proteins [BR:sasa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     106562252
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 106562252
NCBI-ProteinID: XP_013982490
UniProt: A0A1S3KV23
LinkDB
Position
ssa11
AA seq 1358 aa
MSPKVPGHGRAEDTAVQVAVRVRPLLPKELLHSHESCMTADPEQRRVTLGHDRHFHCDFL
FEETSCQEEVYAVCVQPLIEAFFQGFNATVFAYGQTGSGKTYTIGEANLSSFRDEEQGII
PRAVAEVFKLLDENDLSDFSVRVSYLEVYKEDFRDLLEVETASKDIHIREDDKGNIVLCG
VKECEVEGLDEVLSLLESGNTARHTGATQMNPHSSRSHTIFSVHMDQRRGGSRAHGNPTT
GTGPHVLSSKFHFVDLAGSERILRTGNTGERLKESIQINSGLLALGNVIGALGDPKRRGT
HIPYRDSKITRILKDSLGGNAKTLMIACISPSSADFDESLNTLNYAKRARNIQNRATVNC
RGEPDRVEGLEQQIRALRRALENRQRSETRIIARSDPDRRLRPGEGEIIRLQTQSAHYRT
CTDTAYRLLCELQGEGALTVEQGLRVKDWLCSVEEERSGLTTASGPDSGIESSSTEDTAA
LRKGRVAVKNQEAESGREELGREREESVAQLQGQVQQLERENTDFLAALEDAMEQYKQQS
DKLQEQQDVIVELQCLLSGPGVPGLGLHLTPRPHTAPQGSTRHSHNGLANRQVSPVDCVE
SSSFVDQIQCGYGQSSHDHEDLGGGEVKDSEEEDTYVNMSHDRRKHVNLTWTKRDIMGGS
AVGGRGLLSQLPGLPASEQFSTRRPSNSSVGESSVGLGSEWGLLQAQQKIRELSVTIRMK
EELIRELVKTGKDAQALNRQYTRKISALEGEAEQARQEVQEAQRQLQDLEKQEKETSDVT
DRTRAQECRRKIAAAQSKVQVLSQRQRDTAQLASLSAQSERRVSELERSVQGMRQQQEQL
QRRLRHESQQKRRLETEMQRRTHRVKELEIKNEQQQKILRIKTEEIAAFQRQRRSGSNGS
VISLEEQLKIEEQKRWLDEEMESVLEQRKGLEDLEGELTKREQILAKKEALLQERSGLET
KRLRSSQALSEDLVTLSGRIESLERELSDRNGLLRSSSAQDSQQIRQEINNLRQEKDTLL
KQRVELDDKLRQGSLLSPEEERSVFQLDEAIEALDAAIEYKNEAITQRQRQLRASASMLS
QWEMNLMAKLSYLSASETRALLCKYFDKVVSLREEERKLQLALADLEMRGEEQLQLVQWL
ENALDRTQLDTDRRLTQQQKEHERSVQLLLQQCREQMDEGLAGRQRQYEGWIHNLSKELN
HYKAANLELSNRFRELCGNASQPMEQGKVPVFEGRTAGSGSVERLSQSPDDSRRRGPGEP
ERPTRSREEIRELVNTPLPATWRRSSLPTEDPCGMEELQQRVAVETPVNRVVQTGTGPWS
GTTSLPFAKSRRESRRSSLNTGPLISNNSIIDVRKNPV
NT seq 4077 nt   +upstreamnt  +downstreamnt
atgtctcccaaagtgcctggccatggcagggcggaggacacggcggtacaggttgctgtt
cgagtgcgccccctgctgcccaaggagctgctgcacagccacgagagctgcatgacggct
gaccctgagcagcgcagggtcactctgggtcatgaccgacacttccactgtgacttcctg
tttgaggagaccagctgccaggaggaggtgtacgctgtgtgtgtccagcccctcatagag
gccttctttcagggcttcaacgccactgtcttcgcctatgggcagacaggctctggcaag
acatacactatcggagaagccaacctttcttcctttagggatgaggagcagggcatcatc
cccagggctgtggctgaggtcttcaagctgctggatgagaatgacctcagtgacttctct
gtccgagtgtcttacctggaggtatacaaggaggacttcagggacctgctggaggtggag
acagccagcaaggacatccacatcagagaggatgacaagggcaacattgtgctgtgcggg
gtgaaggagtgtgaggtggaggggctggacgaggtgctgagcctgctggagtctggcaac
acggccagacacacaggcgccacccagatgaacccccactctagtcgctcacacaccatc
ttcagcgtgcacatggaccagcgccgcggcggctcccgggcccatggtaaccccaccaca
ggcaccgggcctcacgtcctctcctctaagtttcactttgtggacctagcggggtcggag
agaatcctccgcacagggaacacaggggagaggctgaaggagagcatccagatcaacagt
ggcctgctggccctggggaatgtcataggagccctgggagaccccaagaggagaggcacc
catataccatacagggactccaaaatcaccaggatcttgaaagattctctgggaggaaac
gccaagacgctgatgattgcatgcatcagcccctcctctgcggactttgacgagagcctg
aacacactgaactacgccaagcgagcccgcaacatccagaaccgggccacggtgaactgc
cgaggagagccggaccgtgtggaggggctggagcagcagatccgggcgcttcgcagggcc
cttgagaaccgtcaacgctcagagacccgtatcattgcccgctcggacccagacaggcgg
ttgcgccccggagagggagagatcatcagactgcaaacccagagtgcccactacaggacc
tgcactgacactgcatacaggttgctgtgtgagctgcagggtgagggggcgctgactgtg
gagcaaggcctgagggtgaaggactggctgtgttctgtggaggaagaacgcagcggcctg
accactgcctcaggacctgacagcggcatcgagagcagctccaccgaggacaccgccgct
ctgaggaagggaagggttgccgtcaagaaccaggaggcagagagtggtagggaggagttg
ggccgtgagagggaggagagtgtggctcagctccagggccaggtccagcagctggagaga
gagaacacagacttcctggctgctctggaggacgccatggagcagtacaaacagcagagt
gataagctgcaggagcagcaggacgtgatagtggagctgcagtgtctgctctcggggcca
ggtgtaccggggctgggattacacctgacaccacgcccccacaccgccccccagggctcc
acgcgccactcccacaacggactcgccaacagacaggttagtccagtggactgtgtggag
agcagctcatttgttgaccagatccagtgtggttatggtcaatcttctcatgaccacgag
gacctgggagggggagaggtgaaggactctgaggaggaggacacttacgtcaacatgagc
cacgacagacggaaacacgtgaatctgacttggactaagagagatattatgggtggatca
gcagttggagggagaggtctcctgtctcagctgcctgggctgcctgcctctgaacaattc
tccaccaggcgaccatccaactccagtgtaggggagagctcagtgggtctggggtcagag
tggggcctgctacaagcccagcagaagatcagagagctgtctgtcaccatccgcatgaag
gaggagctcatcagagaactggtcaagacaggtaaggatgcccaggctctgaacaggcag
tacacccgtaagatctctgccctggagggggaagctgagcaggccaggcaggaagtccag
gaggcccagagacagcttcaggacctggagaaacaggagaaggagaccagcgatgtcact
gacaggaccagggcccaggagtgtcgcaggaagatagctgcagcacagagcaaagtacag
gtcctgagccagcgtcagagggacacggcgcagctggcctcactgtctgcacagagcgag
cggcgtgtttcggagctggagcgcagcgtgcagggcatgaggcagcagcaggagcagctg
cagagacgtctgcgacacgagagccaacagaaacgacgcctggagacagagatgcagcga
cgcacgcacagagtcaaggagctggagataaagaatgaacagcagcagaagatcctgagg
ataaagacggaggagattgctgccttccagagacagagacgcagcggcagcaacggctct
gtcatatcactggaggagcagctgaagattgaggagcagaagcgctggctggatgaggag
atggaaagtgttctggagcagaggaaaggactggaggacctggagggagagctgaccaag
agggaacagatcctagccaagaaggaggccctgctgcaggagcgcagtggcctggagacc
aagagactccgctccagtcaggccctcagtgaggacctggtgacgctgtctggccgtatc
gagtctctggagcgggagctgagtgacaggaacggcctgctccgcagcagcagtgcccag
gactcccagcagatccgccaggagatcaacaacctgcgccaggagaaggacacactgctc
aaacagagagttgagctggacgacaaattacggcagggtagtctgctctcaccagaggag
gagcggtctgtgttccagctggacgaggccatcgaggctctggacgcggctatagagtat
aagaacgaggccatcacccagagacagaggcagctgagggcctctgccagcatgctctcc
cagtgggagatgaacctcatggccaaactcagctacctgtctgcctcagagacccgtgcg
ctgctctgcaagtactttgacaaggtggtgtcgctgcgggaggaggagcgtaagctgcag
ctggccctggcagatctggagatgcgtggtgaggagcagctgcagctggtgcagtggctg
gagaacgctctggaccgcacgcagctcgacacggaccgcaggctcacacagcagcagaag
gagcacgagaggagtgtacagctactgctgcagcagtgccgagagcaaatggacgagggc
ctggcgggaaggcagaggcagtacgaaggctggatccataacctcagtaaagagctcaac
cactacaaggctgccaacctggaactgagcaacaggttcagggagctgtgtggcaacgcc
agccaacccatggagcagggaaaggttccggtctttgagggcagaacagcaggcagtggc
agtgtggagaggctgagccaaagcccagacgacagccgtaggagagggccaggggagcca
gagagaccaaccaggtcccgggaggaaataagggagctggtcaacacccctctccctgcc
acatggaggcgctcctccctccccaccgaggacccctgcggcatggaggagctacagcag
cgggtggccgtggagacgcctgtaaaccgggtggttcagacaggcactgggccttggagt
gggacgacatctctgccatttgccaaatcacgcagagagtcccgccgatccagcctcaac
accggaccactgatctcaaacaattccataattgatgtgaggaaaaatcctgtttaa

KEGG   Salmo salar (Atlantic salmon): 106587389
Entry
106587389         CDS       T04363                                 

Definition
(RefSeq) kinesin-like protein kif7
  KO
K18806  kinesin family member 7
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106587389
Cytoskeleton proteins [BR:sasa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     106587389
SSDB
Motif
Pfam: Kinesin Microtub_bd bZIP_1
Other DBs
NCBI-GeneID: 106587389
NCBI-ProteinID: XP_014031218
UniProt: A0A1S3PU52
LinkDB
Position
ssa26
AA seq 1355 aa
MSPKVPGHGRAEDMAVQVAVRVRPLLPKELLHSHESCMTADPEQRRVTLGHNRHFHCDFL
FEETSCQEEVYAVCVQPLIEAFFQGFNTTVFAYGQTGSGKTYTIGEANISSFRDEEQGIV
PRAVAEVFKLLDENDLIDFSVRVSYLEVYKEDFRDLLEVETASKDIHIREDDKGNIVLCG
VKECEAEGLDEVLSLLESGNTARHTGATQMNPHSSRSHTIFSVHMDQRRGGSCAHGNPTT
GTGPHVLSSKFHFVDLAGSERILRTGNTGERLKESIQINSGLLALGNVIGALGDPKRRGT
HIPYRDSKITRILKDSLGGNAKTLMIACISPSSVDFDESLNTLNYAKRARNIQNRATVNC
RGEPDRVEGLEQQIRALRRALENRQRSETRIIARSDPDKRSRPGEGEIITLQAQSAHYRT
CTDTAYRLLCELQGEGALTVEQGLRVKDWLCSVEEERSGLTTASGPDSGIESSSTEDTAA
LRRGRAAIKNQEAESGGEEWGRQKEESVAQLQGQVQQLERENTDFLAALEDAMEQYKQQS
DKLQEQQDVIVELQCLLSGPGVPGLGLHLTPRPHTAPQGSTRHSHNGLTNRQVGPLESSS
FGDQIQCGYGQSSHDHEDLGGGEVKDSEEEDTYVNMSHDRRKHVNLTWTKRDIMGGSAAG
GRGLLSQLPGLPASEQFSTRRPSNSSVGESSVGLGSEWGLLQAQQKIRELSVTIRMKEEL
IRELVKTGKDAQALNRQYTRKISALEGEAEQARQEVQEAQRQLQDLEKQEKETSGVTDRT
RAQECRRKIAAAQSKVQVLSQRQRDTARLASLSAQSERRVSELERSVQGMRQQQEQLQRR
LRHESQQKRRLETEMQRRTHRVKELEIKNEQQQKILRIKTEEIAAFQRQRRSGSNGSVIS
LEEQLKIEEQKRWLDEEMESVLEQRKGLEDLEGELTKREQILAKKEALLQERSGLETKRL
RSSQALSEDLVTLSGRIESLERELSDRNGLLRSSSAQDSQQIRQEINNLRQEKDTLLKQR
VELDDKLRQGSLLSPEEERSVFQLDEAIEALDAAIEYKNEAITQRQRQLRASASMLSQWE
MNLMAKLSYLSASETRALLCKYFDKVVSLREEERKLQLALADLEMRGEEQLQLVQWLENA
LDRTQLDTDRRLTQQQKEHERSVQLLLQQCREQMDEGLAGRQRQYEGWIHNLSKELNHYK
AANLELSNRFRELCGNASQPMEQGKVPVFEGRTAGSGSVERLSRGPDDSRRGGPGEPERP
TRSREEIRELVNAPLPATWRRSSLPTEDPCGMEELQQQVAMETPVKRVVQTGTGPWSGTT
SLPFAKSRRESRRSSLNTGPLISNSSRIDVRKNPV
NT seq 4068 nt   +upstreamnt  +downstreamnt
atgtctcccaaagtgcctggccatggcagggcggaggacatggcggtgcaggtcgctgtt
cgagtgcgccccctgctgcccaaggagctgctgcacagccacgagagctgcatgacggct
gaccctgagcagcgcagggtcactctgggtcacaaccgacacttccactgtgacttcctg
tttgaggagaccagctgccaggaggaggtgtacgctgtgtgtgtccagcccctcatagag
gccttctttcagggcttcaacaccactgtcttcgcctatggacagacgggctctggcaag
acatacactattggagaggccaacatttcttcctttagggatgaggagcagggcatcgtc
cccagggctgtggctgaggtcttcaagctgctggatgagaatgacctcattgacttctct
gtccgagtgtcttacctggaggtgtacaaggaggacttcagggacctgctggaggtggag
acagccagcaaggacatccacatcagagaggatgacaagggcaacattgtgctgtgcggg
gtgaaggagtgtgaggcggaggggctggacgaggtgctgagcctgctggagtctggcaac
acagccagacacacaggtgccacccagatgaacccccactccagccgctcacacaccatc
ttcagcgtgcatatggaccagcgccgcggcggctcctgtgcccatggtaaccccaccacg
ggcaccgggcctcacgtcctctcctctaagttccactttgtggacctggcggggtcggag
aggatcctccgcacagggaacacaggggagaggctgaaggagagcatccagatcaacagt
ggcctgctggccctggggaatgtcataggagccctgggagaccccaagaggagaggcacc
catataccatacagggactccaaaatcaccaggatcttgaaagattctctgggaggaaac
gccaaaacgctgatgattgcatgcattagcccctcctctgtggactttgacgagagcctg
aacacactgaactatgccaagcgggcccgcaacatccagaaccgggccacggtgaactgc
cgaggagagccggaccgtgtggaggggctggagcagcagatccgggcgctccgcagggct
cttgaaaaccgtcagcgctcagagacccgtatcattgcccgctcggacccagacaagcgg
tctcgccccggagagggagagatcatcacactgcaagcccagagtgcccactacaggacc
tgcactgacactgcatacaggttgctgtgtgagctgcagggtgagggggcgctgactgtg
gagcaaggcctgagggtgaaggactggctgtgttctgtggaggaagaacgcagcggcctg
accactgcctcaggacctgacagcggcatcgagagcagctccaccgaggacaccgccgct
ctgaggagggggagggctgccattaagaaccaggaggcagagagtggtggggaggagtgg
ggccgtcagaaggaggagagtgtggctcagctccagggccaggtccagcagctggagaga
gagaacacagacttcctggctgctctggaggacgccatggagcagtacaaacagcagagt
gataagctgcaggagcagcaggacgtgatagtggagctgcagtgcctgctctcggggcca
ggtgtaccagggctgggattacacctgacaccacgcccccacaccgccccccagggctcc
acgcgccactcccacaacggactcaccaacagacaggttggtccactggagagcagctca
tttggtgaccagatccagtgtggttatggtcaatcttctcatgaccacgaggacctggga
gggggagaggtgaaggactctgaggaggaggacacttacgtcaacatgagccatgacaga
cggaaacacgtgaatctgacttggactaagagagatatcatgggtggatcagcagctgga
gggagaggtctcctgtctcagctgcctgggctgcctgcctctgaacaattctccaccagg
cgaccatccaactccagtgtaggggagagctcagtggggctggggtcagagtggggcctg
ctacaggcccagcagaagatcagagagctgtctgtcactatccgcatgaaggaggagctc
atcagagaactggtcaagacaggtaaggacgcccaggctctgaacaggcagtacacccgt
aagatctctgccctggagggggaagctgagcaggccaggcaggaagtccaggaggcccag
agacagcttcaggatctggagaaacaggagaaggagaccagcggtgtcactgacaggacc
agggcccaggagtgtcgcaggaagatagctgcagcacagagcaaagtacaggtcctgagc
cagcgtcagagggacactgcacggctggcctcactgtctgcgcagagcgagcggcgtgtt
tcggagctggagcgcagcgtgcagggcatgaggcagcagcaggagcagctgcagagacgt
ctgcgacacgagagccaacagaaacgacgtctggagacagagatgcagcgacgcacgcac
agagtcaaggagctggagataaagaatgaacagcagcagaagatcctgaggataaagacg
gaggagattgctgccttccagagacagagacgtagcggcagcaacggctctgtcatatca
ctggaggaacagctgaagattgaggagcagaagcgctggctggatgaggagatggaaagt
gttctggagcagaggaaaggactggaggacctggagggagagctgaccaagagggaacag
atcctagccaagaaggaggccctgctgcaggagcgcagtggcctggagaccaagagactc
cgctccagtcaggccctcagtgaggacctggtgacgctgtctggccgtatcgagtctctg
gagcgggagctgagtgacaggaacggcctgctccgcagcagcagtgcccaggactcccag
cagatccgccaggagatcaacaacctgcgccaggagaaggacacactgctcaaacagaga
gtggagctggatgacaaactacgacagggtagtctgctctcaccagaggaggagcggtct
gtgttccagctggacgaggccatcgaggctctggacgcggctatagagtataagaacgag
gccatcacccagagacagaggcagctgagggcctctgccagcatgctctcccagtgggag
atgaacctcatggccaaactcagctacttgtctgcctcagagacccgtgcactgctctgc
aagtactttgacaaggtggtgtcgctgcgggaggaggagcgtaagctgcagctggccctg
gcagatctggagatgcgtggtgaggagcagctgcagctggtgcagtggctggagaacgct
ctggaccgcacgcagctcgacacggaccgcaggctcacacagcagcagaaggagcacgag
aggagtgtacagctactgctgcagcagtgccgagagcaaatggacgagggcctggcgggg
aggcagaggcagtacgaaggctggatccataacctcagtaaagagctcaaccactacaag
gctgccaacctggaactgagcaaccggttcagggagctgtgtggcaacgccagccaaccc
atggagcagggaaaggttccggtctttgagggcagaacagcaggcagtggcagtgtggag
aggctgagccgaggcccagacgacagccgtaggggaggaccaggggagccagagagacca
accaggtcccgggaggaaataagggagctggtcaacgcccctctccctgccacatggagg
cgctcctccctccccactgaggacccctgcggcatggaggagttacagcagcaggtggcc
atggagacgcctgtaaagcgggtggttcagaccggtacgggcccttggagtgggacgaca
tctctgccatttgccaaatcacgcagagagtcccgccgatccagcctcaataccggacca
ttgatctcaaacagttccagaattgatgtgaggaaaaatcctgtttag

DBGET integrated database retrieval system