KEGG   Salmo salar (Atlantic salmon): 106563006
Entry
106563006         CDS       T04363                                 

Definition
(RefSeq) beta-adrenergic receptor kinase 2-like
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04144  Endocytosis
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106563006
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106563006
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     106563006
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   106563006
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106563006
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 106563006
NCBI-ProteinID: XP_013983655
UniProt: A0A1S3KYJ2
LinkDB
Position
ssa11
AA seq 681 aa
MPREETDTRAGKATGGVTTATPGLVSERRFRWVPVDETTLCVCVCVLADGVCFSVSGFLL
FKDFCLTEIDEAVPQLKFYEEIKDYEKLDSEEERLCRSRQIYDGYIMKELLSCSHAFSKK
AVDHVQTHLAKKQVPPSLFQPYIVEICDSLRGVIFQKFIESDKFTRFCQWKNVELNIHLS
MNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNERIMLSLVS
TGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYAAEIILGLEH
MHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPEVLQKGTA
YDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMNVELPDSFSVELKGLLEG
LLQRDVAKRLGCLGRGAPEVKEHLFFKGIDWQQVYLQKYSPPLIPPRGEVNAADAFDIGS
FDEEDTKGIKLLDSDQELYKNFPLVISERWQQEVAETVYEAVNSDTDKNEARKRTKNKPL
GNEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRVEWRGEGESRQNLLTMEQIV
TVEETQIKDKKCILLRIKGGKQFVLQCESDPEFVQWKKELTEAFTEAQKLLRRAPKVIGK
GRAGVVEFSKPPLTHRNSNGL
NT seq 2046 nt   +upstreamnt  +downstreamnt
atgccccgggaagagacggacacacgtgccgggaaggcaacgggcggggttaccacggcg
acgcccgggctagtttctgagcgccgtttccgatgggttcccgtagatgaaacaactttg
tgtgtgtgtgtgtgtgttctcgctgacggtgtgtgtttctctgtttcaggttttctgctg
ttcaaagatttctgtttgactgaaatcgacgaggccgtgccacagctcaagttctacgaa
gagattaaggactacgagaagctggactctgaagaggagaggttgtgccgtagcagacag
atctatgacggatacatcatgaaggaactcctctcctgctcacatgccttctctaagaaa
gcagtggatcacgttcagactcacctggccaagaagcaggtgcctccctctctctttcag
ccgtacatcgtggagatctgtgacagcctgcgaggggtgatcttccagaagttcatagag
agtgacaagttcactcgtttctgccagtggaagaatgtggagctgaacatccatttgtcg
atgaatgacttcagtgtccatcgtatcattggtcgggggggtttcggggaggtgtacggc
tgcaggaaggctgacactggcaagatgtatgccatgaagtgtttggataagaaaaggatc
aagatgaagcagggggagactctggctctgaacgagagaattatgctgtcacttgtcagc
acaggggactgtccgttcatagtgtgcatgacgtacgccttccacacaccagacaaactc
tgcttcattctggacctgatgaacggaggggacctgcactaccacctgtctcagcacggt
gtgttcagtgagaaggagatgcgtttctacgcagcagagatcatcctgggactagaacac
atgcacaaccgcttcgtcgtctacagagacctcaagcctgctaacatcctattggatgag
catggtcacgtgcgtatctcagacctgggtctggcctgcgacttctccaagaagaagcct
cacgccagtgttggtacccatgggtacatggccccggaggtgcttcagaaggggacggcg
tacgacagcagcgccgactggttctcactgggctgcatgctcttcaaactcctccgaggg
cacagtcccttcagacagcacaagaccaaagacaaacacgagattgaccgcatgacgctc
actatgaatgtggagctgccagactcgttctctgtggagctgaagggtctgttggagggt
ctgctgcagagagacgtggccaagagactgggctgcttgggacgaggcgccccagaggtg
aaggagcatctgttcttcaaaggcatcgactggcagcaagtgtatcttcagaagtattct
ccccctctcatccctccaaggggagaggtaaatgcagcagatgcatttgacattggctcc
tttgatgaagaggacaccaagggtatcaagttgttggacagtgaccaggagttgtataag
aacttccccctggtcatctcagagcgctggcagcaggaggtggctgagacggtgtacgag
gcggtcaactccgacacagacaagaacgaggcccgcaagaggaccaagaacaaaccgctg
ggcaacgaggaggactatgccctgggtaaggactgtataatgcacggctacatgttaaag
ctggggaacccgtttctgacacagtggcagcgccggtacttctacctgttccccaaccga
gtggagtggaggggagagggggagtcacggcaaaacctgctgacgatggagcagatcgtg
acggtggaggagacgcagattaaagataagaagtgcatcctgctgcgcatcaaaggaggg
aagcagtttgtcctgcagtgtgagagtgacccagagtttgtccagtggaagaaagagctg
accgaggcgttcactgaggcccagaagctgctgcgtcgagcccctaaggtcatcgggaag
ggtcgggctggtgtggtggagttctctaaacctccgctcacacaccgcaacagcaacggc
ttgtag

KEGG   Salmo salar (Atlantic salmon): 106563091
Entry
106563091         CDS       T04363                                 

Definition
(RefSeq) beta-adrenergic receptor kinase 2-like
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04144  Endocytosis
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106563091
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106563091
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     106563091
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   106563091
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106563091
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 106563091
NCBI-ProteinID: XP_013983795
UniProt: A0A1S3KYZ1
LinkDB
Position
ssa11
AA seq 399 aa
MADLEAVLADVSYLMAMEKSKSTPAARASKKIILPEPSIRSVMQKYLEERDELTFDKIFN
QKIGFLLFKDFCLNEIDEAVPQLKFYEEIKDYEKLDSEEERLCRSRQIYDGYIMKELLSC
SHAFSKKAVDHVQTHLAKKQVPPSLFQPYIVEICDSLRGMIFCKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDK
NT seq 1199 nt   +upstreamnt  +downstreamnt
atggcggacctcgaagcagttctcgccgatgtcagctatttgatggcgatggagaagagc
aaatctactccagcggcccgggcgagcaagaaaatcatactgcctgaacccagtattcgc
agtgtgatgcagaagtacctagaggagagagatgagctaacgttcgacaaaatcttcaac
cagaagatcgggtttctgctgttcaaggatttttgtttgaatgaaatagatgaggccgta
ccacaactcaagttctatgaagaaattaaggattatgagaagctggattctgaagaggag
aggttgtgtcgtagcagacagatctatgatggatacatcatgaaggaactcctctcctgc
tcacatgccttctctaagaaagcagtggatcacgttcagactcacctggccaagaagcag
gtgcctccctctctcttccagccgtacatcgtggagatctgtgacagtctgcgagggatg
atcttctgcaagttcatagagagtgacaagttcactcgtttctgccagtggaagaatgtg
gagctgaacatccatttgacgatgaatgacttcagtgtccatcgtatcattggtcgaggg
ggtttcggggaggtgtacggctgcaggaaggctgacactggcaagatgtatgccatgaag
tgtttggataagaaaaggatcaagatgaagcagggggagactctggctctgaacgagaga
attatgctgtcacttgtcagcacaggggactgtccgttcatagtgtgcatgacgtacgcc
ttccacacaccagacaaactctgcttcattctggacctgatgaacggaggggacctgcac
taccacctgtctcagcacggtgtgttcagtgagaaggagatgcgtttctacgcagcagag
atcatcctgggactagaacacatgcacaaccgcttcgtcgtctacagagacctcaagcct
gctaacatcctattggatgagcatggtcacgtgcgtatctcagacctgggtctggcctgc
gacttctccaagaagaagcctcacgccagtgttggtacccatgggtacatggccccggag
gtgcttcagaaggggacggcgtacgacagcagcgccgactggttctcactgggctgcatg
ctcttcaaactcctccgagggcacagtcccttcagacagcacaagaccaaagacaaaca

KEGG   Salmo salar (Atlantic salmon): 106568375
Entry
106568375         CDS       T04363                                 

Definition
(RefSeq) beta-adrenergic receptor kinase 2
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04144  Endocytosis
sasa04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    106568375
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106568375
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     106568375
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   106568375
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106568375
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Pkinase_fungal Kinase-like
Other DBs
NCBI-GeneID: 106568375
NCBI-ProteinID: XP_013994146
UniProt: A0A1S3LTF5
LinkDB
Position
ssa01
AA seq 688 aa
MADLEAVLADVSYLMAMEKSKSTPAARASKKIILPESSIRSVMQKYLEERDELTFDKIFN
QKIGFLLFKDFCLNEIDEAVPQLKFYEEIKDYEKLDSEEERLCRSRQIYDGYIMKELLSC
SHAFSKKAVDHVQTHLAKKQVPPSLFQPYIVEICDSLRGMIFCKFIESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMNVELPDSFSVE
LKGLLDGLLQRDVVKRLGCLGRGAPEVKEHLFFKGIDWQQVYLQKYSPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDSDQELYKNFPLVISERWQQEVAETVYEAVNSDTDKNEARK
RAKNKQLGHEEDYALGKDCIMHGYMLKLGNPFLTQWQRRYFYLFPNRVEWRGEGESRQNL
LTMEQIVTVEETQIKDRKCILLRIKGGKQFVLQCESDPEFVQWKKELTEAFTEAQKLLRR
APKVIGKGRAGGVELSKPPLTHHNSNGL
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggcggacctcgaagcagttctcgccgatgtcagctatttgatggcgatggagaagagc
aagtctactccagcggcccgagcgagcaagaaaatcatactgcctgaatccagtattcgc
agtgtgatgcagaagtacctggaggaaagagatgagctgacgttcgacaaaatcttcaac
cagaagatcgggtttctgctgttcaaggatttttgtttgaatgaaatagatgaggccgta
ccacaactcaagttctatgaagaaattaaggattatgagaagctggattctgaagaggag
aggttgtgtcgtagcagacagatctatgatggatacatcatgaaggaactcctctcctgt
tcacatgccttctctaagaaagcagtggaccatgttcagactcacctggccaagaaacag
gtgcctccctctctcttccagccgtacatcgtggagatctgtgacagtctgcgagggatg
atcttctgcaagttcatagagagtgacaagttcactcgtttctgccagtggaagaatgtg
gagctgaacatccatttgacgatgaatgacttcagtgtccatcgtatcattggtcgaggg
ggtttcggggaggtgtacggctgcaggaaggctgacactggcaagatgtatgccatgaag
tgtttggataagaaaaggatcaagatgaagcagggggagactctggctctgaacgagaga
attatgctgtcacttgtcagcacaggggactgtccgttcatagtgtgcatgacgtacgcc
ttccacacaccagacaaactctgcttcattctggacctgatgaacggaggggacctacac
taccacctgtctcagcacggtgtgttcagtgagaaggagatgcgtttctatgcagcagag
atcatcctgggactagaacacatgcacaaccgcttcgtcgtctacagagacctcaagcct
gctaacatcctattggatgagcatggtcatgtgcgtatctcagacctgggtctggcctgt
gacttctccaagaagaaacctcacgccagcgttggtacccatggatacatggccccagag
gtgcttcagaaggggacagcgtacgacagcagtgctgactggttctccctgggctgcatg
ctcttcaaactgctcagagggcacagtcccttcagacagcacaagaccaaagacaaacat
gagattgaccggatgacgctcactatgaacgtggagttgccagactcgttctctgtagag
ctgaagggtctattggacggtctgctgcagagagacgtggtgaaaagactgggctgcctg
ggacgaggggccccagaggtgaaggagcatctgttcttcaaaggcattgactggcagcaa
gtgtatctccagaagtattctccccctctcatccctcctagaggagaggtaaatgcagca
gatgcttttgacattggttcctttgatgaggaggacaccaagggcatcaagttgttggac
agtgaccaggagttgtataagaacttccccctggtcatctcagagcgctggcagcaggag
gtggctgagacggtgtacgaggcggtcaactctgacacggacaagaacgaggcccgcaag
agggccaagaacaaacagctgggccacgaggaggactatgccctggggaaggactgtata
atgcacggctacatgttgaagctggggaaccccttcctgacgcagtggcagcgccgatac
ttctacctgttccccaaccgagtggagtggaggggagagggggagtcacggcaaaacctg
ctgacgatggagcagattgtgacggtggaggagacgcagattaaagacaggaagtgcatc
ctgctgcgcatcaaaggagggaagcagtttgtcctgcagtgtgagagtgacccagagttt
gtccagtggaagaaggagctgaccgaggcgttcactgaggcccagaagctgctgcgtcga
gcccctaaggtcatcgggaagggacgggctgggggagtggagctctccaaaccacccctc
acacaccacaacagcaacggcctgtag

DBGET integrated database retrieval system