KEGG   Salmo salar (Atlantic salmon): 106563139
Entry
106563139         CDS       T04363                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10A-like
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04060  Cytokine-cytokine receptor interaction
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106563139
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106563139
   04217 Necroptosis
    106563139
   04115 p53 signaling pathway
    106563139
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106563139
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sasa04050]
    106563139
   04090 CD molecules [BR:sasa04090]
    106563139
Cytokine receptors [BR:sasa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   106563139
CD molecules [BR:sasa04090]
 Proteins
  106563139
SSDB
Motif
Pfam: TNFR_c6 Death DUF4381
Other DBs
NCBI-GeneID: 106563139
NCBI-ProteinID: XP_013983870
UniProt: A0A1S3KZ66
LinkDB
Position
ssa11
AA seq 455 aa
MNFNLTFIKSSVVVFLLCSWLVCCGAELNGVVATQWSGDDRNWTLQHKNCVENQQYLHQG
LCCLNCQAGTFMLRACDRDMEQGTCMPCEHGLSYTEHSNGMNRCLPCTHCRMDQSQIVPC
TSKADTQCQCQAGTFCVPEQACEVCKRCVRCKAGEEEVKKCTPISNTVCRKRDVSTTLHP
IALPTPAPISAETIVTPLVILLLLFLVIVIGVWLWIKRPCTFRPVCLSGSDSRCDSSDIV
KIAIGESGPTAEERQNSQNAGLEGEEVRPESRPLLQETQGGLIKASPPLGLGEDEDRGLG
DSLPNTTSSSQTSLSALPTAGAASSGSSPRHSPSTQRLQPTARDDPLQKRLVSLIGDETS
LKKSFDLFDECLDVRIHNKFFRYIGVHDNHIKMAESAPPGDKVYDLLKNWMQKEGLKADI
NALLQALLSLDQRRSAESIAFAAIQKGYYKHADTP
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgaacttcaatctgacgttcatcaaaagttcggtggtggtgttcctgctgtgctcttgg
ctggtgtgctgtggggcagagctgaatggcgtggtggcgacccagtggtccggcgatgac
aggaactggacgctgcaacacaaaaactgtgtggagaaccagcagtacctccaccagggc
ctctgctgtctcaactgccaggctggtacattcatgctgagggcgtgcgaccgggacatg
gagcaagggacgtgcatgccctgcgaacatggtttgtcctacacagaacactccaacggg
atgaaccgctgcctgccctgtacccactgtcgcatggaccagagccagatagtgccctgt
accagtaaagcagacacccagtgccagtgtcaagcgggcactttctgtgtgccagagcag
gcctgtgaggtctgcaagagatgtgtcaggtgtaaagcgggagaggaggaggtgaagaaa
tgcacccccatctccaacactgtgtgtaggaaacgggacgtctctactaccctccacccg
attgccctccccacccccgcccccatctctgcagagaccatagttacgccattggtcatt
ctgctcttactcttcctcgtcatcgtgattggtgtgtggctttggatcaagaggccatgt
acatttcggccagtttgtctctcaggttcagacagtcgctgtgactccagtgacattgtg
aagattgccattggtgagagtggacccacagcagaggagagacagaacagccagaatgct
ggcctggagggggaggaggtccgtcccgagtcacgtcccctgctgcaggagacccagggc
ggcctgatcaaggcctcccctcccctgggattgggggaggacgaggaccggggcctgggc
gacagcctgcccaacaccaccagctcctcccagaccagcctgtcggccctgcccaccgcc
ggggcagcctcgtcgggcagctccccccgacacagcccctccacccagagactgcagccc
acagccagggatgatcctctgcagaagagactggtgtccctgataggggatgagacgtcc
ctgaagaagagctttgacctcttcgatgagtgcctggacgtgcggatccacaacaagttt
tttcgctacatcggcgtccatgacaaccacatcaagatggcggagagtgccccccctggc
gacaaggtgtatgacctgctgaaaaactggatgcagaaggagggcctgaaggcggacatc
aacgccctgctccaggcccttctcagtctggaccagaggcgctccgctgagagcattgcc
ttcgctgccatccagaagggctactacaaacacgcagacacgccctga

KEGG   Salmo salar (Atlantic salmon): 106567553
Entry
106567553         CDS       T04363                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10A-like
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04060  Cytokine-cytokine receptor interaction
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106567553
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106567553
   04217 Necroptosis
    106567553
   04115 p53 signaling pathway
    106567553
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106567553
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sasa04050]
    106567553
   04090 CD molecules [BR:sasa04090]
    106567553
Cytokine receptors [BR:sasa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   106567553
CD molecules [BR:sasa04090]
 Proteins
  106567553
SSDB
Motif
Pfam: TNFR_c6 Death
Other DBs
NCBI-GeneID: 106567553
NCBI-ProteinID: XP_013992486
UniProt: A0A1S3LNM8
LinkDB
Position
ssa01
AA seq 460 aa
MMIFNLTFMKCSVVVFLLCSGLACCGAELSGVLAAQWSGDDRNRTQRHKTCLENQQYLHQ
DLCCLNCQAGTFVGRACDRDMEQGRCLPCDHGHTYTEHSNGMNHCLPCTHCRKDQSKTVP
CTSTTDTQCQCRAGTFCVPEQACEVCKRCVKCKVGEEEVKKCTPISNTLCRKLDVSPTLH
LPTLPTPAPSSPKTIATPLVILLLLFLLFIGIGVWLCIKKPCTFQPVCLSGSDSRCDSNE
IVKIPIDESGLTAEERQNSQNAGLEEEEAEEVRPESRPLLQETQGRLIKASPPLSLGEDE
DRGLGDSLPNTTSSSQTSLSALPTAGAASSSSSPRHSPSTQRLQPTAGGDPLQKRLVSLL
GEETSLKKSFDLFDECLDVRIHNKFFRYIGVNDNHIKMAERAPPGDKVYDLLKNWMQKEG
LKADINALLQALLSLDQRRSAESIALAAIKRGYYKHADTP
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgatgatcttcaatctgacgttcatgaaatgttcggtggtggtgttcctgctgtgctca
gggctggcgtgctgtggggcggagctcagtggcgtgttggcggcccagtggtccggcgat
gacaggaaccgaacgcagcgacacaaaacctgtctggagaaccagcagtacctccatcag
gacctctgctgcctcaactgccaggccggtacgttcgtgggcagggcgtgcgaccgggac
atggagcaggggagatgcttgccctgtgatcacggccacacctacacagaacactccaac
gggatgaaccactgcctgccctgcacgcactgccgcaaagatcagagtaagacggtaccc
tgtaccagtaccacagacacccagtgccagtgtcgagcgggcaccttctgtgtgccagag
caggcctgtgaggtctgcaagagatgtgtcaagtgtaaagtgggggaggaggaggtgaag
aaatgcacccccatttccaacactttgtgtaggaaactggacgtctctcctaccctccac
cttcctaccctccccactcctgcccccagctcaccaaagaccatagctacgccattggtc
attctgctcctgctcttcctcctcttcattgggattggtgtgtggctttgtatcaagaag
ccatgtacatttcagccagtttgtctctcaggttcagacagtcgctgtgactccaatgag
atcgtgaagattcccatcgatgaaagtggactcacagcagaggagagacaaaacagccag
aacgccggcctggaggaggaagaagcagaggaggtccgtcctgagtcacgccccttgctg
caggagacccagggtaggctgatcaaggcctcccctcccctgagcctgggggaggacgag
gaccgtggcctaggtgacagcctgcccaacaccaccagctcctcccagacaagtctgtca
gccttgcccaccgccggggcagcctcgtcgagcagctctccccgacacagcccctccacc
cagagactgcagcccacagccgggggtgatcctctacagaagagattggtgtccctgcta
ggagaggagacatccctgaagaagagcttcgacctcttcgacgagtgcctggatgtgcgg
atccacaacaagttcttccgctacatcggtgtcaatgacaaccacatcaagatggcagag
agagcccctcctggcgacaaggtatacgacctgttgaagaactggatgcagaaggagggt
ctgaaggcagacatcaacgccctgctccaggcccttctcagcctggaccagaggcgctcc
gctgagagcatcgccttagctgccatcaagaggggctactacaaacacgcagacacgccc
tga

KEGG   Salmo salar (Atlantic salmon): 106580524
Entry
106580524         CDS       T04363                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10B-like
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04060  Cytokine-cytokine receptor interaction
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106580524
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106580524
   04217 Necroptosis
    106580524
   04115 p53 signaling pathway
    106580524
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106580524
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sasa04050]
    106580524
   04090 CD molecules [BR:sasa04090]
    106580524
Cytokine receptors [BR:sasa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   106580524
CD molecules [BR:sasa04090]
 Proteins
  106580524
SSDB
Motif
Pfam: TNFR_c6 Death hEGF MLANA
Other DBs
NCBI-GeneID: 106580524
NCBI-ProteinID: XP_014017165
UniProt: A0A1S3NPJ0
LinkDB
Position
ssa20
AA seq 427 aa
MATPPLSMSYIHLMVVLIWALTPMAAAQSGLELTQTGGSIRNRKQRDISCRENLEYPHDN
ICCLNCPAGKYVKAYCTGALEKGTCEDCDLDTYTEHDNGLRQCLKCTKCRSDQVTTKTCT
ITQNTECQCKPGYFCAPDQACEVCRKCSRCKDNEVRVKNCTTTSNTVCETRLPTSSTISG
KTPGPVVIVVAVLGITAALAGVYWMRRKRFKRTDTQNNPSAMLKVVVDDQNNRSIEERQN
NQNAVLDDTQLHPLLQQTQAVGAKASEDEDNGLGDSLPNTTNSSQSSLSALPSAPLPRSS
PLPSPSAMRQPGTAAGENVVLIKLVPLNGDESLKKSFELFEELDVHYHNRFFRHIGLSDN
AIKSTAHLHPEDRVYELLKVWLEKVGMEADMNDLIKALFYFGQRLSAENIISKAIENGYY
EYAENEK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctacgccacctttgagtatgagctatatacatttgatggttgtcctcatctgggcc
ctcacccccatggcggcagctcaatctggccttgagttgacacagacaggaggcagcatc
aggaacaggaaacagcgggacatctcatgcagggaaaacctggagtacccacatgacaac
atctgctgtttgaattgcccagctggtaaatatgtcaaagcgtactgcacgggtgccttg
gagaaaggaacatgtgaggactgtgacctcgacacatacactgaacatgacaacggactg
cgacagtgcttaaagtgcactaagtgtcgctcagatcaggtgaccacaaagacatgcacc
atcactcagaacacagagtgccagtgtaaaccagggtatttctgtgcccctgaccaagcc
tgcgaggtgtgcagaaagtgctcaagatgtaaagacaatgaggtaagggtgaagaactgc
accactacgtccaacacggtctgtgagaccagactgcccacatccagcaccatctcaggt
aaaactccaggcccagtggtgattgtggtggcagtactgggtatcactgctgcacttgcc
ggtgtctattggatgaggcgaaagcgctttaaaaggacagacacccagaataatcccagt
gcgatgctaaaagtcgtggtggatgatcaaaataacaggtcaattgaggagaggcagaac
aaccagaatgctgtgctggatgacacacagctccatcccttgctgcagcagacccaggcg
gtgggtgccaaagcctcagaggatgaggacaatggactgggcgacagcctccccaacacc
accaactcctcccagtccagtctgtctgcactaccctcagcccccctccccagatcctcc
ccgcttcccagcccttcggccatgaggcagcctggcactgcggctggggaaaatgttgtc
ctcataaaactggttcctttgaatggtgatgagtccttgaagaaaagttttgaacttttt
gaagagctggatgttcactaccataacagattcttcaggcacatcggactctctgacaac
gctataaaaagcactgcgcaccttcatcctgaagatcgagtctatgaactgttgaaagta
tggttggagaaagtgggcatggaagctgacatgaatgacctaattaaagcattattttat
tttggccaaaggttatcagcagaaaatattatttctaaagccattgaaaatggttattat
gaatatgcagaaaatgaaaagtga

KEGG   Salmo salar (Atlantic salmon): 106584955
Entry
106584955         CDS       T04363                                 

Definition
(RefSeq) tumor necrosis factor receptor superfamily member 10B-like
  KO
K04722  tumor necrosis factor receptor superfamily member 10A/B
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04060  Cytokine-cytokine receptor interaction
sasa04115  p53 signaling pathway
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106584955
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106584955
   04217 Necroptosis
    106584955
   04115 p53 signaling pathway
    106584955
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106584955
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:sasa04050]
    106584955
   04090 CD molecules [BR:sasa04090]
    106584955
Cytokine receptors [BR:sasa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   106584955
CD molecules [BR:sasa04090]
 Proteins
  106584955
SSDB
Motif
Pfam: TNFR_c6 Death Miga MLANA
Other DBs
NCBI-GeneID: 106584955
NCBI-ProteinID: XP_014026114
UniProt: A0A1S3PFD0
LinkDB
Position
ssa24
AA seq 444 aa
MEECWCRFSFFGHINWDMYATFDKSMSNIGLHYMVVLLIWALNPMAAAQSGLKLTRTGGS
VRNSKQRDISCRENLEHPHDNICCLNCLAGTYVKAYCTRALERGTCETCEFDTYTEHGNG
LRQCLKCTTCHSDQVTTKACTITQDRECRCKPGLFCAPDQACEVCQKCLRCKENEVRLKN
CTATSNTVCKARLPTSSTISGTRPGPAGVVVIVVAVLGITAAIAAVHWKRRNCCKRRDSQ
NNPSETLKIEVDDQNNRSIEQRQNNRSAVQDDTRLHPLLELTLVVGANTPSADEDNGLGD
SLHNTTNSSQSSLSALPSSSPLSSPSAKRQPGTAATEDVLRKLAPLNGDESLKKSFELFE
ELDVYYHNRFFRHIGLSDNAIKSTAHLHPEDRVYELLKVWLEMVGRQADMNDLIKALLYL
DQKLSAENIIYKAIENGYYEYAVN
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggaggagtgctggtgccgcttttcttttttcggacacatcaactgggatatgtacgcc
acctttgacaaaagtatgagcaatataggcctacattacatggttgtcctcctaatctgg
gccctcaaccccatggcggcagctcagtctggccttaaattgacacggacaggaggtagc
gtcagaaactcgaaacagcgggacatctcatgccgggaaaacctggagcacccacatgac
aacatctgctgtttaaactgcctagctggtacatatgtcaaagcgtactgcacacgtgcc
ttggagaggggaacgtgtgagacctgtgagtttgacacatacactgaacatggcaacgga
ctacgacagtgcttgaagtgcaccacgtgtcactcagatcaggtgactacgaaggcatgc
accatcactcaggacagagagtgccggtgtaaacctgggttattctgtgcccctgaccaa
gcctgtgaggtgtgccaaaagtgcttaagatgtaaagagaacgaggtgaggctgaagaac
tgcaccgccacgtccaacacggtgtgtaaggccagactgcccacatccagcaccatctca
ggtacaagaccaggtccagcgggtgttgttgtgattgtggtggcagtactgggaatcact
gctgcaattgccgctgtccattggaagaggcgaaattgctgtaaaaggagagactcccag
aataatcccagtgagacgctgaaaattgaggtggatgatcaaaacaacaggtcgattgag
cagaggcagaacaaccggagtgctgtgcaggatgacacacggctccatcctttgctggag
ctgaccctggtggtgggcgccaacaccccctcagccgatgaggacaatggactgggcgac
agcctccacaacaccaccaactcctcccagtccagtttgtccgcactaccctcatcctcc
ccgctttccagcccttcggccaagaggcagcctggcactgcggctacggaagatgtcctc
agaaaacttgctcctttgaatggtgacgagtccttgaagaaaagttttgaactttttgaa
gagctggacgtttactaccataacagattcttcaggcacatcggactcagtgacaatgct
ataaaaagcactgcacaccttcatcctgaagaccgagtctatgaactgttaaaagtatgg
ttggaaatggtgggcaggcaagccgacatgaatgacctaatcaaagccttgctttatttg
gaccaaaagttatcagcagaaaatattatttataaagccattgaaaatggttattatgaa
tatgcagtaaattaa

DBGET integrated database retrieval system