KEGG   Salmo salar (Atlantic salmon): 106563284
Entry
106563284         CDS       T04363                                 

Definition
(RefSeq) tyrosine-protein kinase ABL1-like
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106563284
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106563284
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106563284
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     106563284
Protein kinases [BR:sasa01001]
 Non-receptor tyrosine kinases
  ABL family
   106563284
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_9 SH3_2 SH3_3 SH3_6
Other DBs
NCBI-GeneID: 106563284
NCBI-ProteinID: XP_013984224
UniProt: A0A1S3L0Z6
LinkDB
Position
ssa11
AA seq 1099 aa
MGQQPGKFVGDQRRPSLPALNFIKGGKRESSRHGAHHCNVFTVHEALQRPDFEPQGLTEA
ARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTN
HGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISL
RYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTI
YGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYNLTVAVKTLKEDTMEVEEFLK
EAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTHGNLLDYLRECNREEVNAVVLLHMAT
QISSAMEYLERKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKW
TAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMDRPEGCP
EKVYQLMRACWKWNPAERPSFAETHQAFETMFQESSISDEVEKELGKKGKKVTLGPIQQA
PQLPTKTRTLRRNVDRDGDSPDAVEPEVAVSPMLPRKERPFLDSNLNEDDRLLPKDKDKS
RNSLFNLIKKKKKTAPAPPKRSSSFRDMDGHAERLGLAPDPRDDFNNVSSAFSVTHTIDP
SKFPSANNNGVGGITNGGPTYPGPLFPLHHARKKGTPVVPSVVGKTATTPPNEEDIVSNS
KRFLRSSSASSMPPGSERTEWKSVTLPRDLHKGHFDSGTFRSKPALPRKRANEKPEISAP
RMGTLTPPPRLPKKTEDMSDEVFKDAEPSLLTPKLGRRLLGLGVDSSKTSALQAELLKPN
VFPALGAAGDECRARRHKPNLDSSGPRERGKFQKTKPAPPPPPPSSAKISRSPTHELPSP
TDAKASDPHYPSSFSDQVRSPLEAHKKLNLNTSSKPQPLKTSSSSVSGSTSSPLGFSSLN
SPGDQASPTAFIPLMNTRRSLRKTRALPERQPNSAITREMVLEGTELLRTAIGRNSEQTG
SHSAVLEAGKNLSKYCVSYVDSIQQMRNKFAFREAINKLESSLRELQICPAATGGASGAQ
QDFSKLLSSVKEISDIVQR
NT seq 3300 nt   +upstreamnt  +downstreamnt
atggggcagcagccggggaaatttgttggggaccagaggagaccgagtctgccagcgctg
aatttcatcaagggagggaagagggagtcatcacggcatggagcccatcactgtaacgtg
ttcactgttcacgaagctctccagagaccagactttgagccccagggtctgaccgaagcg
gcccgttggaactccaaagaaaatcttttggccggacccagcgagaatgaccccaacttg
tttgttgctctttacgactttgtggccagtggggacaacactctcagcataactaaagga
gagaagctgcgagttttgggttacaaccataatggggagtggtgtgaggcgcagaccaac
cacggccagggctgggtgcccagtaactacatcaccccggtcaacagcctggagaagcac
agctggtaccatgggcctgtgtcgcgcaacgctgctgagtacctgctcagctcgggcatc
aacggcagcttcctggtcagggagagcgagagcagccccgggcagaggtccatctcactg
cgctacgagggacgcgtctaccactacaggatcaacacagcctccgatgggaagctatac
gtgtcgtctgagagtcgtttcaacaccctggcagagctggtgcaccaccactccacggtg
gccgacggcctcatcaccacactgcactacccggcgcccaaacgcaacaagcccaccatc
tacggcgtgtcgcccaactacgacaagtgggagatggagcgcaccgacatcaccatgaag
cacaagctgggcggagggcagtatggagaggtctacgagggggtctggaagaagtacaac
ctcactgtggccgtcaagaccctcaaggaggacaccatggaggtggaggagttcctaaag
gaggctgctgtcatgaaggagatcaaacaccccaacctggtacagctactgggcgtgtgc
acgcgggagcccccgttctacatcatcacagagttcatgacccatggcaacctgctggac
tacctgagggagtgtaacagggaggaggtgaatgctgtggtgctgctccacatggccacg
cagatctcctccgccatggagtacctggagaggaagaactttatccacagggacctggca
gcccgtaactgtctggtaggggagaaccacctggtgaaggtggcagactttgggctgagc
aggctgatgacgggggacacgtacacggcccacgctggggccaagttccccatcaagtgg
accgccccggagagcctggcctacaacaagttctccatcaaatctgacgtctgggcgttc
ggagtgttgctatgggagatcgccacctatgggatgtctccgtaccctggcatagacctc
tcccaggtgtatgagctcctagagaaggactaccgtatggaccggccggagggctgccca
gagaaggtctaccagctcatgagggcctgctggaagtggaaccctgcggaacggccctcc
tttgcagagacccaccaggcatttgagaccatgtttcaggaatccagcatctctgacgag
gtggagaaggagctggggaagaaagggaagaaggtgacactgggccccatccaacaggct
ccacagctgcccaccaagaccaggaccctccgtaggaatgtggacagagatggagacagc
cctgacgccgtggagccggaggtggccgtgtcccccatgctcccaaggaaagagcgtccg
ttcctggacagcaacctgaacgaggacgaccgcctcctgcccaaagacaaggacaagtcc
cgcaacagcctcttcaacctcatcaagaagaagaagaagactgcgcccgccccgcccaaa
cgcagcagctctttcagggacatggacggacatgcggagagactggggctagcgcccgac
ccccgagacgacttcaacaacgtctcctcagccttcagtgttacacataccatcgacccc
agcaagttcccgagtgctaacaacaatggggtagggggtattaccaacgggggccccacc
tacccaggccccctgttccccctgcatcatgccaggaagaaaggtacgccggtggtgccc
agtgtagtgggtaaaacagccaccaccccacccaatgaggaggatatagtctctaactcc
aagcgtttcctgcgctcctcctcggcctctagcatgcccccgggctcagagcgcactgag
tggaagtcagtcacgctgccacgtgacctgcacaaaggccactttgactcgggcaccttt
aggagcaagcccgccctgccacgcaagagggccaacgagaagccagagatcagcgcccct
cgcatgggcaccctgacgcccccgccccgcctgcccaagaagacagaggacatgtcagac
gaggtgtttaaggacgctgagcccagcctcctgacgcccaagcttggcagaaggcttcta
gggttgggggtggacagctccaagaccagcgccctgcaggccgagctgctcaagcccaac
gtgttccctgctttgggggcagccggggatgagtgcagggcccgccgccacaaacccaac
ctggactcctccggccccagggagagaggcaagttccagaagaccaaacctgctccccct
ccacccccaccctccagtgccaagatctcccgcagccccactcacgagctcccctcaccc
acagatgccaaggcctcagacccccactacccatctagcttcagtgaccaagtccggtct
cccctggaggcccacaagaaacttaacctcaacacctcctccaaaccacagccattaaag
acctcctcctcttcagtgtctggctctacctccagccccctgggcttctcctccctcaac
tccccaggagaccaggcctctcccacagcctttatccccttgatgaacacccgccgctcc
ctgaggaagacacgtgcgctcccggagcgccaacccaactcggctatcaccagggagatg
gtcctggagggcacggagctgctgcgcaccgccatcggacgcaactctgagcagacaggc
agccacagcgccgtgctagaggcgggcaagaacctgtccaagtactgcgtcagctacgtg
gactccatccagcagatgaggaacaagtttgccttccgcgaggccatcaacaagctggag
agcagtctgcgcgagctgcagatctgccctgctgccaccgggggcgccagcggagcacag
caggacttcagcaagctgctctcgtctgtcaaagagatcagtgacatcgttcagaggtag

KEGG   Salmo salar (Atlantic salmon): 106566947
Entry
106566947         CDS       T04363                                 

Definition
(RefSeq) tyrosine-protein kinase ABL1-like
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
sasa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106566947
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106566947
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106566947
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     106566947
Protein kinases [BR:sasa01001]
 Non-receptor tyrosine kinases
  ABL family
   106566947
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_9 SH3_2 SH3_3 SH3_6
Other DBs
NCBI-GeneID: 106566947
NCBI-ProteinID: XP_013991106
UniProt: A0A1S3LJM4
LinkDB
Position
ssa01
AA seq 1102 aa
MGQQPGKFVGDQRRPSLPTLHFIKGGKRESSRHGAHHCNVFAVHEALQRPDFEPQGLTEA
ARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTN
HGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISL
RYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTI
YGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLK
EAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTHGNLLDYLRECNREEVNAVVLLHMAT
QISSAMEYLERKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKW
TAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMDRPEGCP
EKVYQLMRACWKWNPTERPSFAETHQAFETMFQESSISDEVEKELGKKGKKVVLGPMQQA
PQLPTKTRTLRRNVDRDGDSPDAVEPEVAVSPMLPRKERPFLDSNLNEDDRLLPKDKDKS
RNSLFNLIKKKKKTAPAPPKRSSSFREMDGHPERRGLAPDHRDNDFNNGSFSDTHTNDPN
KVLGANNNGAGGITNGAPTYPGPLFPPHHARKKCTPVVPSVSGKTATTPPSEEDIVSNSK
RFLRSSSASSMSPGSDRTEWKSVTLPRDLHKGHFDSGTFGGKPALPRKRANEKPEISIPR
MGTLTPPPRLPKKTEDPSDEVFKDAESSPQTLTPKLSRRLPGQGLDSSKTSTLQAELLKP
NVFPTLGAAGDECRARRHKHNLDSSGPRERGKFQKPKPAPPPPPPSSAKSGKISRSPTQE
LPSPTDTKAKASDSHNPSSPSDQARSLLEGHKKLSLSTSSKPQPSKTSSSSVSGSTSSPL
GFSSPGDQTSPTAFIPLMNTRRSLRKTRAPPERQPNSAITREMVLEGTELLRTAIGRNSE
QTGSHSAVLEAGKNLSKYCVSYVESIQQMRNKFAFREAINKLESSLRELQICPAATGGAS
GAQQDFSKLLSSVKEISDIVQR
NT seq 3309 nt   +upstreamnt  +downstreamnt
atggggcagcagccggggaagtttgttggggaccagaggagaccgagtctgccgacgctg
cacttcatcaagggtgggaagagagagtcatcacgacatggggcccatcactgtaacgtc
ttcgctgtgcatgaagctctccagagaccagactttgagccccagggtctgaccgaagcg
gcccgttggaactccaaagagaacctgttggccggacccagcgagaatgaccccaacctt
tttgttgcgctatacgactttgtggccagtggggacaacactctcagcataactaaagga
gagaagctgcgagtcctgggttataaccataatggggagtggtgcgaggcgcagaccaac
cacggccagggctgggtgcccagtaactacatcaccccggtcaacagcctggagaagcac
agctggtaccatgggcctgtgtcgcgcaacgctgctgagtacctgctcagctcgggcatc
aacggcagcttcctggtcagggagagcgagagcagccccgggcagaggtctatctcactg
cgctacgagggccgcgtctaccattacaggatcaacacggcctccgacgggaagctatat
gtgtcgtctgagagtcgattcaacaccctggcagagctggttcaccaccactccacggta
gccgatggcctcatcaccacgctgcactacccggcgcccaaacgcaacaagcccaccatc
tacggcgtgtcgcccaactacgacaagtgggagatggagcgcaccgacatcaccatgaag
cacaagctgggcgggggccagtacggagaggtctacgagggggtctggaagaagtacagc
ctcaccgtggccgtcaagaccctcaaggaggacaccatggaggtggaggagttcctaaag
gaggctgctgtcatgaaggagatcaaacaccccaacctggtacagctactgggcgtgtgc
acgcgggagcccccgttctacatcatcacagagttcatgacccatggcaacctgctggac
tacctgagggagtgtaacagggaggaggtgaatgctgtggtgctgctccacatggccacg
cagatctcctccgccatggagtacctggagaggaagaacttcatccacagggacctggca
gcccgtaactgtctggtgggggagaaccacctggtgaaggtggcagacttcgggctgagc
aggctgatgacgggggacacgtacacggcccacgctggggccaagttccccatcaagtgg
accgccccggagagcctggcctacaacaagttctccatcaaatctgacgtctgggcgttc
ggagtgttgctgtgggagatcgccacctatgggatgtctccgtaccctggcatagacctc
tcccaggtgtatgagctcctagagaaggactaccgcatggaccggccggagggctgccca
gagaaggtctaccagctcatgagggcctgctggaagtggaaccctaccgagcggccctcc
tttgctgagacccaccaggcctttgagaccatgtttcaggagtccagcatctctgatgag
gtggagaaggagttgggtaagaaagggaagaaggtggtgctgggccccatgcagcaggct
ccacaactgcccaccaagaccaggaccctccgtaggaacgtggaccgagatggagacagc
cctgacgccgtggagccggaggtggccgtgtcccccatgctcccaaggaaagagcgtccg
ttcctggacagcaacctgaacgaggacgaccgcctgctacccaaagacaaggacaagtcc
cgcaacagcctcttcaacctcatcaagaagaagaagaagacagcgcctgccccgcccaaa
cgcagcagctctttcagggagatggacggacacccggagagacgggggctggcgcccgac
caccgagacaacgactttaacaacggctccttcagtgatacacataccaacgatcccaac
aaggttctgggtgctaacaacaacggggcagggggtattaccaatggggcgcccacctac
ccgggccccctgttccccccgcatcatgccaggaagaagtgtacgccggtggtgcccagt
gtaagtggtaagactgccaccactccacccagcgaggaggatatagtatctaactcgaaa
cgtttcctgcgctcctcctcggcctccagcatgtccccaggctcggatcgcactgagtgg
aagtcggtcacgctgccccgtgacctgcacaaaggccattttgactcgggcaccttcggg
gggaagcccgccctgccccgcaagagggccaacgagaagccagagatcagcatccctcgc
atgggcaccctcacccccccaccccgcctgcccaagaagacagaggatccatcagatgag
gtgtttaaggatgcggagtccagcccccagaccctgacgcccaagcttagtaggaggctt
ccagggcaggggctagacagctccaagaccagcaccctgcaggccgagctgctcaagccc
aacgtgtttcccactctgggggcagctggggacgagtgcagggcccgccgccacaaacac
aacctggactcctccggtcccagggagagaggaaagttccagaagcccaagcctgctccc
cctccacccccgccctccagtgccaagtcaggcaagatctcccgcagccccactcaggag
ctcccctctcccacagacaccaaagccaaggcctcagactcccacaacccatccagcccc
agtgaccaagctcgctctctcctggagggccacaagaaactcagcctcagcacctcctct
aaaccacagccgtcaaagacctcctcttcctcagtgtctggctccacctccagccccctg
ggtttctcctccccaggagaccagacctctcccacagccttcatccccctcatgaacacc
cgacgctccctgaggaagacgcgtgcgcccccagagcgccagcccaactctgccatcacc
agggagatggttctggagggcacagagctgctgcgcactgccatcggacgcaactctgag
cagacaggcagccacagcgccgtgctggaggcgggcaagaacctgtccaagtactgcgtg
agctacgtggagtccatccagcagatgaggaacaagtttgccttccgcgaggccatcaac
aagctggagagcagtctgcgcgagctgcagatctgccctgctgccactgggggtgccagc
ggagcgcagcaggacttcagcaagctgctctcgtctgtcaaagagatcagtgacatcgtt
cagaggtag

KEGG   Salmo salar (Atlantic salmon): 106584319
Entry
106584319         CDS       T04363                                 

Definition
(RefSeq) Abelson tyrosine-protein kinase 2-like
  KO
K08887  abelson tyrosine-protein kinase 2 [EC:2.7.10.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106584319
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106584319
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     106584319
Protein kinases [BR:sasa01001]
 Non-receptor tyrosine kinases
  ABL family
   106584319
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 SH3_6
Other DBs
NCBI-GeneID: 106584319
NCBI-ProteinID: XP_014024919
UniProt: A0A1S3PBM6
LinkDB
Position
ssa23
AA seq 1191 aa
MGQQVGRVGEGASTGLQPPPPQQHPGKGNRGSTGRRPREVSSTGTAPGRVAAVNVPDPAI
NIFTKHSEALHRPFGLDSAALTEAVRWSSKENLLGAAESDPNLFVALYDFVASGDNTLSI
TKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLS
SLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTASDGKVYVTAESRFSTLAELVHHH
STVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYGEVYVGVWK
KYNLTVAVKTLKEDTMEVEEFLKEAAVMKEVKHPNLVQLLGVCTLEPPFYIVTEYMPHGN
LLDYLRECDREEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENSVVKVADF
GLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPG
IDLSQVYDLLEKGYRMEQPEGCPPKVHELMRACWQWSPLDRPSFAETHQAFETMFHDSSI
SEEVAEELCKTAASGHAPSPHPFSHDMPLLPSKSRTLKMHAENKENIEGGLDGRQEPSTH
GPSGLAATLLAGDGRSGSSPALPRKQRDKSPSSLLEDSQETMFTRDRKAGFFSSFMKKKS
PSSQLQQSLPMPPKRSSSFREMETQPHKKYEPTAGFSAPPLPQADGLGFSPSHGEGNHVQ
SRCCGATFGQKSSANHTSGAPPLQVGSSSSSWAGLAGFFTPRLIKKTLGLRTGKSTGTEE
GGGGTKPFPRSNSTSSMTAGLPDLERMALTLPRNRSKPPLERTASTTSQPENGAAHTSET
LLRKMDEGTAQIRDRPKAKLLPRGVGGCSGGVRAPGVGSEADLDCHSGALRCREGQEAGG
QDRQGWTSPSKTVGSGPLAAPHNHKVPVLISPTLKHSPADVHLVGMDSQGNRFKLLSEHQ
ADRDRPRLVKPKCAPPPPPTLRLIGHSYSGDGEEQVVGAVEVNGDGVKRPGRAREVGTGR
PSVPPPQVPPPTSASSFSSANNTNTTPTKMANGATSTASSTAPSGGSKPLRRTRQQAERV
QPEKISKEALLECAECLRGALHSSPEPSSSSQVLDAGHQLLDYCSGYVDCIPQMRNKFAF
REAVGKLELSLQELRASSSSGIGGAFSGPGTSPALDNLHICIKEISDVVQR
NT seq 3576 nt   +upstreamnt  +downstreamnt
atgggacaacaggtaggccgcgtcggtgagggggcttcaacaggactccaaccgccacca
ccgcaacaacacccgggcaaggggaacaggggaagtacagggaggagaccccgggaagtc
agcagtaccggaacggcaccaggcagggttgctgccgttaacgtgccggacccagcaatt
aatatattcaccaagcattcagaggccctccaccggcccttcggcctggactcggcagca
ttgacggaggcggtacgctggagctccaaggagaacctgctgggtgctgccgagagcgat
cccaacctctttgttgcactttatgactttgttgccagtggcgacaacacgctgagcatc
acgaaaggtgagaagctaagggtgctcggttacaaccagaatggggagtggagcgaggtg
cgctcgaagaacggccagggctgggtgccaagcaactacattacgcccgtcaacagcctg
gagaagcacagctggtaccacgggcctgtgtcgcgcagcgcagcagaatacctgctcagc
agcctcatcaacggtagcttcctggtccgggagagcgagagcagcccaggacagctgtca
atctccctgcgctacgagggaagagtctaccactaccgcatcaacactgcttcagatggc
aaggtgtacgtcacggcagagagccgcttcagcaccctggccgagctggtgcaccaccac
tccaccgtggccgacggcctggtcaccacactccactacccggcgcccaagtgcaacaag
cccaccgtctacggcgtgtcgcccatccacgacaagtgggagatggagcgcaccgacatc
accatgaagcacaaactgggtggggggcagtacggagaggtgtacgtgggagtctggaag
aaatacaacctcaccgtcgcagttaaaacactgaaggaggacaccatggaggtggaggag
ttcctgaaagaggcagcagtcatgaaggaggtgaaacatcccaacctggtgcagctgcta
ggtgtgtgtactttggagcctcccttctacatcgtgacagagtacatgcctcacggcaac
ctgctggactacctgagggagtgtgaccgggaggaggtaaacgctgtggtgctgctctac
atggccacgcagatctcctccgccatggagtacctggagaagaagaacttcatccaccgg
gacctggcggccaggaactgtctggtgggggagaacagcgtggtgaaggtggctgacttt
gggctgagcaggctgatgactggcgacacgtacacagcccacgccggagccaagttcccc
attaagtggacagccccggaaagtctggcctacaacaccttctctatcaagtctgatgtg
tgggctttcggtgtgctgctgtgggagatagcgacgtacggtatgtctccgtacccaggg
atcgacctgtctcaggtatacgacctgctggagaagggctaccgcatggagcagccagag
ggctgtccacctaaagtccatgagctgatgagggcctgctggcaatggagcccgttggac
cgaccttcgtttgccgagacccaccaggcctttgagacaatgttccacgattccagcatc
tccgaagaggtagcagaggagctgtgtaagactgccgcctctggccatgccccgtcacca
caccccttcagccacgacatgccactgctgccctcgaagtcgcgcactctcaagatgcac
gcggagaacaaggagaacatcgaggggggtttggatggcaggcaggagcccagcacacac
ggcccctcaggtctggcagccactctgctggcaggggatggccggtcaggcagctctcct
gctctgcctcggaaacagagggacaaatcccccagcagcctcttggaggactcccaggag
accatgttcacacgggaccgcaaggctggcttcttcagctccttcatgaagaagaagtct
ccttcatcccagctgcagcagagcctgcccatgccgcctaagaggagcagctcgtttcga
gagatggagacccagcctcacaagaagtacgagcccacggctggcttcagcgctcctccc
cttccccaggcggacggcctgggcttctcaccgtcccatggagaggggaaccatgtccag
tcacggtgctgtggggccacttttggacaaaagtcctctgccaaccacacctctggggcc
ccgcccttgcaggtgggcagtagtagcagcagctgggcaggcctggcaggtttcttcacc
cctcgcctcatcaaaaagaccttagggctacggactggcaagtccactgggaccgaagag
ggaggtggggggaccaaaccattccccaggtccaactccacctcctccatgactgcaggg
ctgcctgacctggagaggatggctctgactttacccagaaaccgcagtaaacctcctcta
gagcgcactgcctccaccacctcgcagcctgagaacggggcagcacacacctctgagacc
cttcttcgtaagatggatgagggcacggctcagatcagggaccggcctaaagccaagttg
cttccccgaggggtgggggggtgctctgggggggtgagggcacctggggttgggagtgag
gccgatttggattgtcactcgggggctctacggtgtagggagggtcaggaggcaggagga
caggaccgacagggatggacgtccccctccaaaacagtgggatcaggcccgttggcggct
ccacacaaccacaaggttcccgtgctgatctcgcctacactcaagcatagcccagccgat
gtgcacctggtggggatggactctcaggggaaccgcttcaaactgctatcggagcaccag
gcggaccgggaccgaccacgactggtcaaaccgaaatgtgctccccctccccctccaacc
ctgcgcctcattgggcactcctacagcggggatggggaggaacaggtcgtaggggctgtg
gaggtcaacggtgatggggtgaaaaggccgggacgagcaagggaagtgggaaccgggaga
ccatcagtgccaccaccacaagtgcctccaccaacttcagcctcctccttttcctctgcc
aacaacactaacactacccccactaagatggccaacggtgccacaagcactgcctcttcc
acagccccctctggtggctctaagcctctgcgtcggactcgacagcaggctgagagggtt
caaccggagaagatcagtaaggaggctttgctggagtgtgctgagtgcctgagaggtgcc
ctccacagcagccctgagccctcctccagcagccaggtcttagatgctggccaccagctg
ctagactactgctcaggctacgtggactgcatcccacagatgcggaacaagtttgccttc
cgggaggccgtgggcaaattagagctgagtctgcaggagctgcgggcatcgtcctcctct
ggaattggaggggcattcagtggcccaggaactagccctgctctggacaacttacacatc
tgcatcaaagaaatcagtgatgtggttcagaggtag

KEGG   Salmo salar (Atlantic salmon): 106613905
Entry
106613905         CDS       T04363                                 

Gene name
abl2
Definition
(RefSeq) ABL proto-oncogene 2, non-receptor tyrosine kinase
  KO
K08887  abelson tyrosine-protein kinase 2 [EC:2.7.10.2]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    106613905 (abl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106613905 (abl2)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     106613905 (abl2)
Protein kinases [BR:sasa01001]
 Non-receptor tyrosine kinases
  ABL family
   106613905 (abl2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 SH3_6
Other DBs
NCBI-GeneID: 106613905
NCBI-ProteinID: XP_014072137
UniProt: A0A1S3T6C1
LinkDB
Position
ssa10
AA seq 1226 aa
MGQQVGRVGEGASTGLPPPQQQQQHPGKGNRGNAGRRPREVSNVSTGTPTGRVTAVNVPD
PAINIFTQHSGLLLRVPLDPVRLILSSHLGWTVMQQALHRPFGLDSAALTEAVRWSSKEN
LLGAAESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSN
YITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHY
RINTASDGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDK
WEMERTDITMKHKLGGGQYGEVYVGVWKKYNLTVAVKTLKEDTMEVEEFLKEAAVMKEVK
HPNLVQLLGVCTLEPPFYIVTEYMPHGNLLDYLRECDREEVNAVVLLYMATQISSAMEYL
EKKNFIHRDLAARNCLVGENSVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYN
TFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVHELMRA
CWQWSPLDRPSFAETHQAFETMFHDSSISEEVAEELCKTASSGHGPSPHSFNHDMPLLPS
KSRTLKKHTENKENIEGGLDCRQETHTASTHSHSGLAATLLAGDGRSGSSPALPRKQRDK
SPSSLLEDSQETTFTRDRKAGFFSSFMKKKSSSNSPSSQLQQSLPTPPKRSSSFREMETQ
PHKKYEPTTGFSAPPPPLPQADGLGFSPSHGEGNHIQSRCCGATFGQKASANHTSGAPPS
QVGSSSSSSWAGLAGFFTPRLIKKTLGLRTGKSTGTEEGDGGTKPFPRSNSTSSMSAGLP
DLERMALTLPRNRSKPPLERTASTTSQPENGAAHTSETLLRKMDEGTAQIRDRPKAKLLP
RVVGGSSGVVRAPGVGSEADSYCPSGTLRGTEVQEAGGQDRQGWSSPSKTVGSGLSAAPH
NHKVPVLISPTLKHGSADVHLVGMDSQGNRFKLLSEHQADRDRPRLVKPKCAPPPPPTLR
LLGHSYSGDGEEQAGVAVEVNGDGVKRPGRVREVGTGRPSVPPPQVPPPPSASSSSANNT
TPTKMANGATSTGSSTVPSGGSKLLRRTRQQAERVQPEKISKEVLLECAECLRGALHSSP
EPSSSSQVLDAAHQLLDYCSGYVDCIPQMRNKFAFREAVGKLELSLQELRASSSSGSGGA
FSGPGASPALDNLHTCIKEISDVVQR
NT seq 3681 nt   +upstreamnt  +downstreamnt
atgggacaacaggtaggccgcgttggtgagggggcttcgacagggctgccaccgccacaa
caacagcagcaacacccggggaaggggaacaggggaaacgccgggaggagaccccgggaa
gtcagtaacgttagcactggaacaccgacaggcagggttactgccgttaacgtgccggac
ccagcaattaatatattcacccagcattcaggacttttgctccgagtcccacttgatcct
gtcaggctgatcctatcatctcatcttggctggactgtgatgcaacaggccctccaccgg
cccttcggcctggactcggcagcgttgacggaggcggtgcgctggagctccaaggagaac
ttgctgggtgctgccgagagcgaccctaacctctttgttgcactttatgactttgttgcc
agtggcgacaacacgctgagcattacaaaaggtgagaagctgagggtgctaggctacaac
cagaatggggagtggagcgaggtgcgctccaagaacggccagggctgggtgccaagcaac
tacatcacgcccgtcaacagcctggagaagcacagctggtaccacgggcccgtttcgcgc
agcgctgcagaatacctgctaagcagcctcatcaatggcagcttcctggtccgggagagc
gagagcagcccaggacagctgtccatctccctgcgctacgaggggcgtgtctaccactac
cgcatcaacaccgcctcagatggcaaggtttacgtcacagcagagagccgcttcagcacc
ctggccgaactggtccaccaccactccaccgtggccgacggcctggtcaccacgctccac
tacccggcacccaagtgcaacaagcccaccgtctatggtgtgtcacccatccacgacaag
tgggagatggagcgcaccgacatcaccatgaagcacaagctgggaggcgggcagtatgga
gaggtgtacgtgggagtctggaagaaatacaacctcaccgtcgcagtcaaaacactcaag
gaggacactatggaggtggaggagttcctgaaagaggcagcagtcatgaaggaggtgaaa
catcccaacctggtgcagctgctaggtgtgtgtacgttggagcctcccttctacatcgtg
acagagtacatgccccacggcaacctgctggactacctgagggagtgtgaccgggaggaa
gtgaatgctgtggtgctgctctacatggccacgcagatctcctccgccatggagtacctg
gagaagaagaacttcatccaccgggacctggcggccaggaactgtctggtgggggagaac
agcgtggtgaaggtggctgactttgggctgagcaggctgatgacgggggacacgtacacg
gcccacgccggagccaagttccccatcaagtggaccgcccccgagagcctggcctacaac
accttttctatcaagtctgatgtgtgggctttcggtgtgctgctgtgggagatagcgacg
tacggtatgtctccgtacccagggatcgacctgtctcaggtatacgacctgctggagaag
ggctaccgcatggagcagccagagggctgtccgcccaaggtccacgagctgatgagagcc
tgctggcaatggagcccgttggaccgaccctcgtttgccgaaacccaccaggcttttgag
acaatgttccacgattccagcatctccgaagaggtagcagaggagctgtgtaagactgcc
tcctctggccacggcccgtcaccacactccttcaaccacgacatgcccctgctgccctcc
aagtcgcgcacgctcaagaagcatacggagaacaaggagaacatcgaggggggtctggat
tgcaggcaggagacacacacagccagcacccacagccactcaggtctggcagccactctg
ctggcaggggatggccggtcagggagctctcctgctctgcctcggaaacagagggacaaa
tcccccagcagcctcttggaggactcccaggagaccacgttcacacgggaccgcaaggct
ggcttcttcagttctttcatgaagaagaagtcttcctccaactctccctcctcccagctg
cagcagagcctgcctacgccgcccaagaggagcagctcgttcagggagatggagacccag
cctcacaagaagtatgagcccacgactggcttcagcgcacctcctcccccccttccccag
gcagatggcctgggcttttcaccatcccacggagaggggaaccacatccagtcacgctgc
tgtggagccacttttggacaaaaggcctctgccaaccacacctctggggccccgccctca
caggtgggcagtagtagcagcagcagctgggcaggcctggcaggcttcttcaccccccgc
ctcatcaaaaagaccttagggctacggactggcaagtctactgggaccgaggagggggat
gggggaaccaagcccttccccaggtccaattccacctcctccatgtctgcagggctgcct
gacctggagaggatggctctgactttacccaggaaccgcagtaagcctcctctagagcgc
actgcctccaccacctcgcagcctgagaacggggcagcacacacctctgagacccttctc
cgtaagatggatgagggcacagctcagatcagggaccggcctaaagccaagctgcttccc
cgagtggtgggggggagctctggggtggtgagagctcctggcgttgggagtgaggcagat
tcatattgtccctcagggaccctacggggtacggaggttcaggaggcaggaggacaggac
cgtcagggatggtcgtccccctccaaaacagtgggatcgggcctgtcagcggctccacac
aaccacaaggttccagtgctgatctcgcccacactcaagcatggctcggccgatgtgcac
ctggtggggatggactctcaggggaatcgcttcaaactactatcagagcatcaggcggac
cgggaccgaccacggctggtcaagcctaaatgtgccccacctccccctcccactctgcgc
ctccttggacactcctacagcggggatggagaggagcaggccggggtggctgtggaggtc
aatggtgatggggtgaaaaggccgggaagagtaagggaagttggaacagggagaccgtca
gtgccgccaccacaagtgcctccacctccttcagcctcctcttcctctgccaacaacact
acccctactaagatggctaacggtgccaccagcactggctcatccacagtcccctctggt
ggctctaagcttctgcgtcggactcggcagcaggcagagagggttcaaccggagaagatc
agtaaggaggttctgctggagtgtgctgagtgcctgagaggtgccctccacagcagccct
gagccctcctccagcagccaggtcctagacgctgctcaccagctgctagactactgctca
ggctacgtggactgcatcccacagatgcggaacaagtttgccttccgggaggccgtgggc
aaattagagctcagtttgcaggagctgcgggcatcgtcctcctctggaagcggaggagca
ttcagtggcccaggggctagccctgctctggacaacttgcacacctgcatcaaggaaatt
agtgatgtggttcagaggtag

DBGET integrated database retrieval system