KEGG   Salmo salar (Atlantic salmon): 106563377
Entry
106563377         CDS       T04363                                 

Definition
(RefSeq) erythropoietin-like
  KO
K05437  erythropoietin
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106563377
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:sasa04052]
    106563377
Cytokines and growth factors [BR:sasa04052]
 Cytokines
  CSF and other factors
   106563377
SSDB
Motif
Pfam: EPO_TPO Y_phosphatase
Other DBs
NCBI-GeneID: 106563377
NCBI-ProteinID: XP_013984355
UniProt: A0A1S3L0K6
LinkDB
Position
ssa11
AA seq 129 aa
MSSISGPVVVLLTVLQWAGRGLPSPVRPICDPRVLDPFIMEARDTETALRGCKAGCGVTG
TFVVLLTNVDFVVWETKDDLPLPPAPAVGDSVTRKVSSLSELLHVHTNFLRGKGRLLLTN
APACQQNST
NT seq 390 nt   +upstreamnt  +downstreamnt
atgtcttccatttcagggccggtggtggtactgctgactgtactccagtgggcaggacga
ggcctcccttctcctgtcaggcccatctgtgacccgcgcgtcctggatcccttcatcatg
gaggcccgcgacacagagaccgctctgcgaggttgcaaggcagggtgtggagtgacaggc
acatttgtggttcttctgacaaatgttgactttgtagtctgggagacaaaggatgacctg
ccccttcctccagcaccagcagtaggtgactcagtgactaggaaggtgtcgtccttatct
gagctgctccatgtccacaccaacttcctacgagggaagggtcgccttctgctcaccaat
gcacctgcctgtcaacagaacagcacttga

DBGET integrated database retrieval system